Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1YP54

Protein Details
Accession A0A1Y1YP54    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-52MMDPRRPSKDIEAKRRRNSDNRRGDKRDFSRKEPTKQNNYDKNKKDGBasic
NLS Segment(s)
PositionSequence
11-37RPSKDIEAKRRRNSDNRRGDKRDFSRK
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
Pfam View protein in Pfam  
PF13650  Asp_protease_2  
Amino Acid Sequences MALLGMMDPRRPSKDIEAKRRRNSDNRRGDKRDFSRKEPTKQNNYDKNKKDGYNHNSGKDFSTRPSEKQNYYKDSRTSSNNPIPKTALLMQAGSEYEEFVPEAKISNLRTKEGLQDLNVLYDTGSQINMIHPQLAKEMGLKTEDRPLTFTTAAGKVLIPQVTEEFKIKIKLVEERTGKVKWYDFNTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.54
3 0.62
4 0.69
5 0.75
6 0.83
7 0.88
8 0.85
9 0.85
10 0.86
11 0.85
12 0.85
13 0.85
14 0.86
15 0.84
16 0.82
17 0.82
18 0.8
19 0.81
20 0.75
21 0.72
22 0.73
23 0.74
24 0.76
25 0.76
26 0.77
27 0.76
28 0.8
29 0.84
30 0.83
31 0.85
32 0.86
33 0.81
34 0.79
35 0.74
36 0.68
37 0.65
38 0.65
39 0.62
40 0.62
41 0.61
42 0.58
43 0.54
44 0.51
45 0.47
46 0.41
47 0.35
48 0.27
49 0.32
50 0.3
51 0.3
52 0.39
53 0.42
54 0.43
55 0.5
56 0.54
57 0.52
58 0.55
59 0.57
60 0.5
61 0.49
62 0.47
63 0.45
64 0.43
65 0.45
66 0.47
67 0.47
68 0.44
69 0.42
70 0.4
71 0.34
72 0.32
73 0.25
74 0.21
75 0.17
76 0.16
77 0.15
78 0.14
79 0.14
80 0.11
81 0.09
82 0.06
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.06
91 0.08
92 0.1
93 0.17
94 0.18
95 0.19
96 0.2
97 0.21
98 0.24
99 0.25
100 0.24
101 0.18
102 0.2
103 0.19
104 0.19
105 0.18
106 0.14
107 0.1
108 0.1
109 0.1
110 0.06
111 0.06
112 0.06
113 0.06
114 0.07
115 0.1
116 0.1
117 0.11
118 0.11
119 0.12
120 0.13
121 0.13
122 0.13
123 0.12
124 0.13
125 0.12
126 0.14
127 0.15
128 0.15
129 0.22
130 0.24
131 0.22
132 0.24
133 0.24
134 0.27
135 0.26
136 0.25
137 0.21
138 0.21
139 0.21
140 0.19
141 0.17
142 0.14
143 0.17
144 0.18
145 0.14
146 0.14
147 0.16
148 0.18
149 0.2
150 0.2
151 0.18
152 0.2
153 0.24
154 0.23
155 0.24
156 0.24
157 0.31
158 0.35
159 0.42
160 0.43
161 0.43
162 0.47
163 0.45
164 0.45
165 0.41
166 0.4
167 0.37