Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2B421

Protein Details
Accession A0A1Y2B421   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-38IRSINDKKVKGNMKKFERKNKEAAFKSHydrophilic
431-462AAHPNEKFEPRKRTRGKSSSLRRYLRKQTHVIHydrophilic
NLS Segment(s)
PositionSequence
21-30KGNMKKFERK
440-449PRKRTRGKSS
Subcellular Location(s) nucl 13.5, cyto_nucl 9.333, cyto_mito 4.333, cyto 4, mito 3.5, plas 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012952  BING4_C_dom  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
IPR019775  WD40_repeat_CS  
IPR036322  WD40_repeat_dom_sf  
IPR040315  WDR46/Utp7  
Gene Ontology GO:0016020  C:membrane  
GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF08149  BING4CT  
PROSITE View protein in PROSITE  
PS00678  WD_REPEATS_1  
PS50082  WD_REPEATS_2  
PS50294  WD_REPEATS_REGION  
Amino Acid Sequences MNKYNRGQSGEIRSINDKKVKGNMKKFERKNKEAAFKSVQSELLLTEEAGYLEAEGMEKTYKFTQEQIKENVDLSTQAKMFNLELDKLGPYTFDYTRNGRDMLIAGKKGHISTFNWKNGKLGCELFLNETVRDAKWLHNETMFAVAQKKYTYIYDSTGMELHCLRKHTEVNKLEFLPYHFLLVTIGNAGWLKYQDTSTGNRVAEFNTKLGRCDCMVQNPYNGIINLGHSNGTVTLWSPSMSSPLVKMLCHKAPIQSIAIDNGGYYMATAGLDSRVKIWDLRTYKELQNYLSPTPASSLSISQKGLLAVGFGPHVNIWKDAFKEKQKSPYMSHLQPSCSIKTVKFCPFEDILGLGHDKGFSSIVIPGSGEPNFDSLEANPYETVKQRREKEVHDLLEKLQPETIALNPNFIGSVDRASKDIIEEEKKLEWEAAHPNEKFEPRKRTRGKSSSLRRYLRKQTHVIDEKKVNIIAIYIYIYIYIYIFLFFLYISF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.58
3 0.58
4 0.51
5 0.47
6 0.54
7 0.61
8 0.64
9 0.68
10 0.71
11 0.75
12 0.83
13 0.88
14 0.9
15 0.89
16 0.86
17 0.86
18 0.85
19 0.84
20 0.79
21 0.77
22 0.73
23 0.67
24 0.64
25 0.56
26 0.48
27 0.38
28 0.34
29 0.26
30 0.21
31 0.17
32 0.14
33 0.11
34 0.11
35 0.1
36 0.1
37 0.09
38 0.07
39 0.06
40 0.07
41 0.06
42 0.06
43 0.07
44 0.08
45 0.08
46 0.12
47 0.15
48 0.18
49 0.19
50 0.25
51 0.34
52 0.39
53 0.46
54 0.49
55 0.5
56 0.48
57 0.48
58 0.42
59 0.33
60 0.29
61 0.23
62 0.22
63 0.18
64 0.18
65 0.17
66 0.18
67 0.18
68 0.19
69 0.21
70 0.16
71 0.17
72 0.17
73 0.18
74 0.17
75 0.16
76 0.12
77 0.11
78 0.15
79 0.16
80 0.18
81 0.21
82 0.25
83 0.3
84 0.32
85 0.31
86 0.26
87 0.26
88 0.24
89 0.26
90 0.28
91 0.26
92 0.24
93 0.25
94 0.27
95 0.26
96 0.26
97 0.22
98 0.21
99 0.28
100 0.36
101 0.43
102 0.44
103 0.44
104 0.46
105 0.46
106 0.44
107 0.38
108 0.3
109 0.24
110 0.23
111 0.24
112 0.23
113 0.24
114 0.24
115 0.2
116 0.2
117 0.2
118 0.18
119 0.19
120 0.18
121 0.18
122 0.24
123 0.28
124 0.28
125 0.27
126 0.28
127 0.26
128 0.29
129 0.25
130 0.18
131 0.18
132 0.17
133 0.17
134 0.17
135 0.17
136 0.14
137 0.15
138 0.17
139 0.15
140 0.17
141 0.19
142 0.19
143 0.19
144 0.2
145 0.19
146 0.17
147 0.16
148 0.17
149 0.16
150 0.18
151 0.18
152 0.21
153 0.27
154 0.29
155 0.37
156 0.4
157 0.42
158 0.45
159 0.44
160 0.4
161 0.36
162 0.34
163 0.29
164 0.23
165 0.19
166 0.15
167 0.14
168 0.14
169 0.13
170 0.11
171 0.07
172 0.06
173 0.06
174 0.06
175 0.06
176 0.06
177 0.07
178 0.07
179 0.08
180 0.08
181 0.1
182 0.12
183 0.15
184 0.18
185 0.23
186 0.22
187 0.22
188 0.22
189 0.21
190 0.24
191 0.22
192 0.2
193 0.2
194 0.2
195 0.21
196 0.21
197 0.21
198 0.16
199 0.19
200 0.19
201 0.21
202 0.25
203 0.24
204 0.25
205 0.24
206 0.24
207 0.21
208 0.2
209 0.13
210 0.1
211 0.1
212 0.09
213 0.09
214 0.09
215 0.07
216 0.08
217 0.07
218 0.06
219 0.05
220 0.05
221 0.05
222 0.05
223 0.06
224 0.06
225 0.06
226 0.08
227 0.08
228 0.08
229 0.07
230 0.11
231 0.12
232 0.11
233 0.14
234 0.16
235 0.18
236 0.2
237 0.2
238 0.19
239 0.19
240 0.21
241 0.2
242 0.16
243 0.15
244 0.14
245 0.13
246 0.1
247 0.09
248 0.07
249 0.06
250 0.05
251 0.04
252 0.03
253 0.03
254 0.03
255 0.03
256 0.03
257 0.05
258 0.06
259 0.06
260 0.07
261 0.07
262 0.08
263 0.09
264 0.1
265 0.16
266 0.19
267 0.21
268 0.23
269 0.27
270 0.29
271 0.33
272 0.33
273 0.27
274 0.29
275 0.3
276 0.28
277 0.25
278 0.22
279 0.18
280 0.18
281 0.17
282 0.13
283 0.11
284 0.13
285 0.14
286 0.17
287 0.17
288 0.16
289 0.17
290 0.15
291 0.15
292 0.11
293 0.09
294 0.06
295 0.06
296 0.06
297 0.05
298 0.06
299 0.06
300 0.08
301 0.09
302 0.1
303 0.11
304 0.13
305 0.15
306 0.19
307 0.25
308 0.3
309 0.37
310 0.4
311 0.48
312 0.52
313 0.54
314 0.54
315 0.58
316 0.57
317 0.53
318 0.55
319 0.49
320 0.44
321 0.45
322 0.45
323 0.37
324 0.33
325 0.31
326 0.27
327 0.3
328 0.35
329 0.37
330 0.38
331 0.38
332 0.39
333 0.38
334 0.37
335 0.31
336 0.26
337 0.18
338 0.15
339 0.15
340 0.1
341 0.09
342 0.09
343 0.08
344 0.08
345 0.08
346 0.06
347 0.07
348 0.09
349 0.09
350 0.09
351 0.1
352 0.1
353 0.12
354 0.12
355 0.12
356 0.1
357 0.11
358 0.11
359 0.11
360 0.11
361 0.09
362 0.14
363 0.14
364 0.15
365 0.14
366 0.15
367 0.17
368 0.22
369 0.29
370 0.31
371 0.39
372 0.43
373 0.53
374 0.56
375 0.58
376 0.61
377 0.63
378 0.61
379 0.56
380 0.52
381 0.45
382 0.45
383 0.41
384 0.33
385 0.25
386 0.19
387 0.17
388 0.17
389 0.18
390 0.21
391 0.2
392 0.22
393 0.2
394 0.21
395 0.2
396 0.18
397 0.17
398 0.1
399 0.15
400 0.17
401 0.17
402 0.18
403 0.19
404 0.19
405 0.18
406 0.21
407 0.22
408 0.23
409 0.25
410 0.27
411 0.29
412 0.29
413 0.29
414 0.26
415 0.2
416 0.2
417 0.28
418 0.32
419 0.37
420 0.37
421 0.39
422 0.43
423 0.5
424 0.54
425 0.53
426 0.57
427 0.57
428 0.68
429 0.74
430 0.78
431 0.82
432 0.83
433 0.84
434 0.83
435 0.87
436 0.87
437 0.88
438 0.87
439 0.84
440 0.84
441 0.86
442 0.85
443 0.82
444 0.79
445 0.75
446 0.78
447 0.8
448 0.75
449 0.73
450 0.69
451 0.64
452 0.6
453 0.54
454 0.44
455 0.34
456 0.3
457 0.22
458 0.17
459 0.15
460 0.11
461 0.1
462 0.1
463 0.1
464 0.09
465 0.09
466 0.08
467 0.07
468 0.07
469 0.07
470 0.06
471 0.06