Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2EWN5

Protein Details
Accession A0A1Y2EWN5    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
238-261LLSGWNKKTAEKKLKNSNDNNFYDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013783  Ig-like_fold  
IPR000535  MSP_dom  
IPR008962  PapD-like_sf  
IPR016763  VAP  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF00635  Motile_Sperm  
PROSITE View protein in PROSITE  
PS50202  MSP  
Amino Acid Sequences MDFVTFEPSDSLHFVKKSNSRNLDGFKIKTTSPHKFCVRPSVGKILPNKKSEISVYIRIHENKKLNSVSSDKFLIQTTVISSDIANLSQEQSIEKIGEEFKKLDKLKKTSPAEVANLLKEHKLLCDISGLPNISIDDSKKAVTLNSSESPKDKSLASPLTPNVASPDKKSRTELNENELLEKNPNNIGEANAIIKELENAIQKYSADSLKNDLVKTGSFISESINDDTTKKINEQTGLLSGWNKKTAEKKLKNSNDNNFYDVSYILI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.3
3 0.38
4 0.44
5 0.51
6 0.55
7 0.55
8 0.6
9 0.63
10 0.64
11 0.63
12 0.57
13 0.51
14 0.47
15 0.42
16 0.44
17 0.47
18 0.48
19 0.46
20 0.53
21 0.55
22 0.58
23 0.6
24 0.63
25 0.62
26 0.58
27 0.58
28 0.59
29 0.55
30 0.55
31 0.61
32 0.6
33 0.6
34 0.56
35 0.55
36 0.47
37 0.46
38 0.43
39 0.4
40 0.36
41 0.38
42 0.37
43 0.37
44 0.42
45 0.44
46 0.45
47 0.46
48 0.47
49 0.4
50 0.45
51 0.43
52 0.39
53 0.39
54 0.41
55 0.35
56 0.32
57 0.32
58 0.26
59 0.25
60 0.24
61 0.21
62 0.16
63 0.14
64 0.12
65 0.11
66 0.11
67 0.1
68 0.09
69 0.1
70 0.1
71 0.1
72 0.09
73 0.08
74 0.08
75 0.09
76 0.09
77 0.08
78 0.08
79 0.09
80 0.08
81 0.08
82 0.08
83 0.11
84 0.12
85 0.14
86 0.14
87 0.15
88 0.23
89 0.26
90 0.3
91 0.35
92 0.39
93 0.44
94 0.52
95 0.54
96 0.5
97 0.53
98 0.5
99 0.44
100 0.42
101 0.37
102 0.29
103 0.26
104 0.22
105 0.17
106 0.15
107 0.13
108 0.09
109 0.1
110 0.09
111 0.08
112 0.1
113 0.1
114 0.11
115 0.13
116 0.13
117 0.11
118 0.11
119 0.11
120 0.09
121 0.09
122 0.08
123 0.08
124 0.08
125 0.09
126 0.09
127 0.09
128 0.09
129 0.09
130 0.1
131 0.13
132 0.16
133 0.18
134 0.18
135 0.19
136 0.22
137 0.22
138 0.21
139 0.17
140 0.15
141 0.19
142 0.21
143 0.21
144 0.21
145 0.21
146 0.23
147 0.22
148 0.21
149 0.19
150 0.2
151 0.2
152 0.21
153 0.3
154 0.31
155 0.33
156 0.36
157 0.39
158 0.42
159 0.5
160 0.49
161 0.45
162 0.46
163 0.45
164 0.45
165 0.41
166 0.34
167 0.26
168 0.24
169 0.2
170 0.18
171 0.17
172 0.16
173 0.15
174 0.15
175 0.14
176 0.14
177 0.13
178 0.1
179 0.1
180 0.09
181 0.08
182 0.08
183 0.07
184 0.1
185 0.13
186 0.13
187 0.14
188 0.16
189 0.16
190 0.17
191 0.19
192 0.2
193 0.17
194 0.18
195 0.21
196 0.25
197 0.28
198 0.27
199 0.25
200 0.23
201 0.21
202 0.22
203 0.2
204 0.15
205 0.13
206 0.13
207 0.14
208 0.16
209 0.19
210 0.19
211 0.19
212 0.19
213 0.19
214 0.22
215 0.22
216 0.21
217 0.2
218 0.22
219 0.25
220 0.26
221 0.27
222 0.27
223 0.27
224 0.26
225 0.25
226 0.25
227 0.26
228 0.28
229 0.31
230 0.29
231 0.31
232 0.39
233 0.48
234 0.55
235 0.6
236 0.66
237 0.72
238 0.82
239 0.87
240 0.88
241 0.87
242 0.85
243 0.78
244 0.72
245 0.62
246 0.52
247 0.43