Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2AU51

Protein Details
Accession A0A1Y2AU51   
Localization Confidence Low
Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPKISKKKSCKLTPKEIYDKLKDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, mito_nucl 11.166, nucl 9, cyto_mito 8.166, cyto_nucl 6.666, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011257  DNA_glycosylase  
IPR003265  HhH-GPD_domain  
IPR000445  HhH_motif  
Gene Ontology GO:0003677  F:DNA binding  
GO:0016798  F:hydrolase activity, acting on glycosyl bonds  
GO:0006285  P:base-excision repair, AP site formation  
Pfam View protein in Pfam  
PF00633  HHH  
CDD cd00056  ENDO3c  
Amino Acid Sequences MPKISKKKSCKLTPKEIYDKLKDEFGDPPWWPGDSYIVMVQSILVQNTTWSSVEKITTKAKTIKYLTEWYGKYKYNVESVMKIGKTELRKELLAIKGIGPETADVILVYVFHKPSFVIDAYTRRLLERLGFSFKDDSEIRSFFEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.84
4 0.81
5 0.76
6 0.71
7 0.62
8 0.56
9 0.48
10 0.4
11 0.35
12 0.31
13 0.31
14 0.27
15 0.28
16 0.25
17 0.25
18 0.23
19 0.2
20 0.2
21 0.14
22 0.16
23 0.14
24 0.13
25 0.13
26 0.12
27 0.11
28 0.1
29 0.1
30 0.08
31 0.07
32 0.06
33 0.07
34 0.08
35 0.09
36 0.08
37 0.08
38 0.09
39 0.1
40 0.12
41 0.13
42 0.16
43 0.2
44 0.21
45 0.24
46 0.29
47 0.3
48 0.34
49 0.34
50 0.34
51 0.32
52 0.35
53 0.34
54 0.34
55 0.33
56 0.31
57 0.33
58 0.31
59 0.28
60 0.28
61 0.27
62 0.23
63 0.25
64 0.22
65 0.2
66 0.2
67 0.23
68 0.2
69 0.18
70 0.16
71 0.18
72 0.19
73 0.21
74 0.23
75 0.21
76 0.21
77 0.22
78 0.27
79 0.24
80 0.24
81 0.21
82 0.18
83 0.18
84 0.18
85 0.17
86 0.12
87 0.1
88 0.09
89 0.08
90 0.08
91 0.05
92 0.05
93 0.05
94 0.05
95 0.06
96 0.07
97 0.07
98 0.07
99 0.08
100 0.08
101 0.09
102 0.12
103 0.12
104 0.14
105 0.17
106 0.22
107 0.27
108 0.3
109 0.29
110 0.26
111 0.27
112 0.25
113 0.26
114 0.27
115 0.27
116 0.3
117 0.3
118 0.33
119 0.34
120 0.33
121 0.34
122 0.29
123 0.29
124 0.28
125 0.28