Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2AGM8

Protein Details
Accession A0A1Y2AGM8   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
149-171NIKQLKYLEEYKKKSKKKGCIISHydrophilic
NLS Segment(s)
PositionSequence
160-166KKKSKKK
Subcellular Location(s) cyto 13, mito 5, nucl 4, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029021  Prot-tyrosine_phosphatase-like  
IPR000242  PTP_cat  
IPR003595  Tyr_Pase_cat  
IPR000387  Tyr_Pase_dom  
IPR020422  TYR_PHOSPHATASE_DUAL_dom  
Gene Ontology GO:0005769  C:early endosome  
GO:0005886  C:plasma membrane  
GO:0004725  F:protein tyrosine phosphatase activity  
GO:0008138  F:protein tyrosine/serine/threonine phosphatase activity  
GO:0006470  P:protein dephosphorylation  
Pfam View protein in Pfam  
PF00102  Y_phosphatase  
PROSITE View protein in PROSITE  
PS50056  TYR_PHOSPHATASE_2  
PS50054  TYR_PHOSPHATASE_DUAL  
CDD cd14500  PTP-IVa  
Amino Acid Sequences MYTQNIILPNPPSLIEYKTLKFLIMDAPSTSNLDIYIEEMKKYNVTDLVRVCEPTYPKERVEAKKINVHDWPFNDGEPPPVMVVKHWKELVNNVFKNEDSQSKKPCIAIHCVAGLGRAPVLVAIALIEEGMNALDSVSYIRERRRGAINIKQLKYLEEYKKKSKKKGCIIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.24
4 0.24
5 0.28
6 0.28
7 0.26
8 0.24
9 0.23
10 0.24
11 0.21
12 0.21
13 0.18
14 0.19
15 0.2
16 0.21
17 0.2
18 0.14
19 0.12
20 0.11
21 0.1
22 0.1
23 0.15
24 0.15
25 0.15
26 0.16
27 0.17
28 0.17
29 0.18
30 0.18
31 0.16
32 0.17
33 0.21
34 0.22
35 0.25
36 0.25
37 0.25
38 0.24
39 0.22
40 0.23
41 0.23
42 0.27
43 0.26
44 0.25
45 0.32
46 0.4
47 0.41
48 0.48
49 0.5
50 0.47
51 0.5
52 0.51
53 0.47
54 0.44
55 0.41
56 0.36
57 0.31
58 0.31
59 0.26
60 0.24
61 0.22
62 0.18
63 0.17
64 0.14
65 0.13
66 0.09
67 0.09
68 0.09
69 0.08
70 0.16
71 0.16
72 0.19
73 0.2
74 0.2
75 0.2
76 0.26
77 0.31
78 0.32
79 0.31
80 0.29
81 0.29
82 0.28
83 0.29
84 0.26
85 0.27
86 0.24
87 0.29
88 0.32
89 0.34
90 0.36
91 0.36
92 0.37
93 0.32
94 0.33
95 0.3
96 0.27
97 0.24
98 0.23
99 0.21
100 0.18
101 0.16
102 0.09
103 0.07
104 0.05
105 0.05
106 0.04
107 0.04
108 0.04
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.02
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.04
124 0.06
125 0.09
126 0.12
127 0.16
128 0.22
129 0.25
130 0.28
131 0.35
132 0.41
133 0.46
134 0.53
135 0.59
136 0.63
137 0.63
138 0.63
139 0.56
140 0.51
141 0.49
142 0.48
143 0.49
144 0.49
145 0.55
146 0.61
147 0.71
148 0.77
149 0.82
150 0.83
151 0.83