Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2E5E9

Protein Details
Accession A0A1Y2E5E9   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-26LPFGSKTEKKGNKPSNNDFSFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 11, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039289  CHCHD4  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0015035  F:protein-disulfide reductase activity  
GO:0045041  P:protein import into mitochondrial intermembrane space  
Amino Acid Sequences QRNKNLPFGSKTEKKGNKPSNNDFSFNSETGEINWNCPCLGDITKGLCAKEYKAAFSCYIYSQAYPKGMYCIEKIQRNTRLVQKIPKCLKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.72
3 0.76
4 0.76
5 0.77
6 0.81
7 0.8
8 0.76
9 0.71
10 0.62
11 0.58
12 0.53
13 0.44
14 0.36
15 0.26
16 0.22
17 0.21
18 0.27
19 0.21
20 0.18
21 0.19
22 0.18
23 0.17
24 0.16
25 0.15
26 0.1
27 0.11
28 0.11
29 0.12
30 0.13
31 0.17
32 0.18
33 0.18
34 0.17
35 0.16
36 0.16
37 0.2
38 0.19
39 0.18
40 0.19
41 0.21
42 0.2
43 0.2
44 0.21
45 0.15
46 0.18
47 0.16
48 0.15
49 0.15
50 0.17
51 0.18
52 0.17
53 0.17
54 0.16
55 0.17
56 0.19
57 0.19
58 0.25
59 0.3
60 0.36
61 0.41
62 0.47
63 0.53
64 0.54
65 0.57
66 0.57
67 0.6
68 0.58
69 0.64
70 0.62
71 0.65