Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H0ES51

Protein Details
Accession H0ES51    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-42KGASAPSGIKKKKKKSKPTVNEEGLSHydrophilic
NLS Segment(s)
PositionSequence
15-33KLKGASAPSGIKKKKKKSK
Subcellular Location(s) nucl 20, cyto_nucl 14.333, mito_nucl 10.999, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPSDDYTPIVRGGLKLKGASAPSGIKKKKKKSKPTVNEEGLSKAIDSDAGSSKKAAAQEEEGLDLRELEPKDFDGKTATERAYEETRRKRPFSKALKVYSASIILPSFSVYPNTPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.21
4 0.23
5 0.23
6 0.22
7 0.22
8 0.23
9 0.27
10 0.36
11 0.42
12 0.48
13 0.56
14 0.66
15 0.73
16 0.79
17 0.83
18 0.85
19 0.9
20 0.91
21 0.91
22 0.9
23 0.85
24 0.77
25 0.66
26 0.57
27 0.47
28 0.36
29 0.26
30 0.16
31 0.11
32 0.09
33 0.08
34 0.07
35 0.11
36 0.12
37 0.13
38 0.13
39 0.13
40 0.14
41 0.16
42 0.14
43 0.11
44 0.11
45 0.13
46 0.13
47 0.14
48 0.13
49 0.12
50 0.11
51 0.1
52 0.08
53 0.11
54 0.11
55 0.1
56 0.1
57 0.11
58 0.14
59 0.14
60 0.14
61 0.12
62 0.13
63 0.15
64 0.19
65 0.18
66 0.16
67 0.17
68 0.2
69 0.24
70 0.3
71 0.36
72 0.42
73 0.51
74 0.57
75 0.6
76 0.62
77 0.65
78 0.69
79 0.7
80 0.71
81 0.7
82 0.7
83 0.71
84 0.68
85 0.61
86 0.53
87 0.44
88 0.34
89 0.27
90 0.21
91 0.16
92 0.14
93 0.13
94 0.12
95 0.11
96 0.14