Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2ADP0

Protein Details
Accession A0A1Y2ADP0    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MKKELKEEKKEKEKKKEEKLKKKNYIIEKINBasic
NLS Segment(s)
PositionSequence
3-23KELKEEKKEKEKKKEEKLKKK
Subcellular Location(s) nucl 16, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
Pfam View protein in Pfam  
PF13637  Ank_4  
PROSITE View protein in PROSITE  
PS50297  ANK_REP_REGION  
PS50088  ANK_REPEAT  
Amino Acid Sequences MKKELKEEKKEKEKKKEEKLKKKNYIIEKINNKRDNNETLLTSECKQGNIEEVKKLIRYGMNINRKNKDGDTPLLIACKNGNIELIKYLLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.91
3 0.91
4 0.91
5 0.93
6 0.94
7 0.94
8 0.93
9 0.91
10 0.87
11 0.85
12 0.84
13 0.79
14 0.78
15 0.77
16 0.76
17 0.78
18 0.77
19 0.69
20 0.63
21 0.6
22 0.54
23 0.48
24 0.4
25 0.31
26 0.25
27 0.26
28 0.25
29 0.21
30 0.21
31 0.17
32 0.16
33 0.16
34 0.14
35 0.17
36 0.2
37 0.21
38 0.18
39 0.19
40 0.2
41 0.2
42 0.2
43 0.17
44 0.14
45 0.14
46 0.21
47 0.29
48 0.39
49 0.45
50 0.51
51 0.53
52 0.53
53 0.54
54 0.48
55 0.45
56 0.39
57 0.37
58 0.34
59 0.33
60 0.32
61 0.32
62 0.3
63 0.24
64 0.2
65 0.19
66 0.16
67 0.15
68 0.17
69 0.16
70 0.17
71 0.18