Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2C2A9

Protein Details
Accession A0A1Y2C2A9    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
18-39LQELRNKYKNKLNNKRQRDESGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013169  mRNA_splic_Cwf18-like  
Pfam View protein in Pfam  
PF08315  cwf18  
Amino Acid Sequences METNLNMLNNAEQRKKNLQELRNKYKNKLNNKRQRDESGLLNDNEEIINEVTVESVVEKYAKETLDKEKEKTSEINLQNLAPKKPNWDLKRDLEKRLEKLEKKTQICINEIIRERLKNSGDISSMPTSVEEMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.51
3 0.56
4 0.59
5 0.61
6 0.65
7 0.72
8 0.77
9 0.77
10 0.76
11 0.72
12 0.71
13 0.72
14 0.72
15 0.73
16 0.74
17 0.75
18 0.81
19 0.84
20 0.82
21 0.8
22 0.76
23 0.67
24 0.62
25 0.58
26 0.53
27 0.45
28 0.4
29 0.33
30 0.26
31 0.23
32 0.17
33 0.12
34 0.07
35 0.07
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.04
44 0.05
45 0.05
46 0.06
47 0.08
48 0.09
49 0.09
50 0.12
51 0.19
52 0.28
53 0.3
54 0.3
55 0.32
56 0.32
57 0.33
58 0.32
59 0.28
60 0.29
61 0.28
62 0.3
63 0.27
64 0.27
65 0.3
66 0.31
67 0.29
68 0.23
69 0.22
70 0.23
71 0.29
72 0.38
73 0.36
74 0.4
75 0.45
76 0.51
77 0.61
78 0.6
79 0.59
80 0.59
81 0.61
82 0.58
83 0.62
84 0.62
85 0.56
86 0.6
87 0.65
88 0.65
89 0.62
90 0.64
91 0.6
92 0.54
93 0.53
94 0.5
95 0.44
96 0.43
97 0.43
98 0.43
99 0.42
100 0.4
101 0.39
102 0.4
103 0.38
104 0.34
105 0.33
106 0.31
107 0.28
108 0.27
109 0.31
110 0.27
111 0.25
112 0.22
113 0.2