Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2AL58

Protein Details
Accession A0A1Y2AL58    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-28KKELEEEKKEKEKKKEEKLEKKNYIIEBasic
NLS Segment(s)
PositionSequence
9-23KKEKEKKKEEKLEKK
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
Pfam View protein in Pfam  
PF13637  Ank_4  
PROSITE View protein in PROSITE  
PS50297  ANK_REP_REGION  
PS50088  ANK_REPEAT  
Amino Acid Sequences MKKELEEEKKEKEKKKEEKLEKKNYIIEKINNKRDNNETLLTSECKQGNIEEVKKLIRYGMNINRKNKDGDTPLLIACKNRNIELIKYLLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.84
3 0.86
4 0.87
5 0.9
6 0.92
7 0.92
8 0.89
9 0.83
10 0.78
11 0.71
12 0.67
13 0.61
14 0.57
15 0.57
16 0.59
17 0.65
18 0.64
19 0.61
20 0.58
21 0.57
22 0.54
23 0.48
24 0.4
25 0.31
26 0.25
27 0.26
28 0.25
29 0.21
30 0.21
31 0.17
32 0.16
33 0.16
34 0.14
35 0.17
36 0.2
37 0.21
38 0.18
39 0.19
40 0.2
41 0.2
42 0.2
43 0.17
44 0.14
45 0.14
46 0.21
47 0.29
48 0.39
49 0.45
50 0.51
51 0.53
52 0.53
53 0.54
54 0.48
55 0.45
56 0.39
57 0.37
58 0.34
59 0.33
60 0.32
61 0.32
62 0.31
63 0.27
64 0.25
65 0.28
66 0.27
67 0.26
68 0.3
69 0.31
70 0.34
71 0.35