Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1YGV4

Protein Details
Accession A0A1Y1YGV4    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
274-294KVNLDVQERKEKKRKIKIKYFBasic
NLS Segment(s)
PositionSequence
282-292RKEKKRKIKIK
Subcellular Location(s) nucl 17.5, cyto_nucl 13.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010106  RpnA  
Pfam View protein in Pfam  
PF12784  PDDEXK_2  
Amino Acid Sequences MADLFKPEENDSVINMEATTKDDERINIEIQINEDREMYKRTLFYASKIIHPSLLFGNKYKKIPKVVMINILNFNLLNNTKEEMTIPHWEFTLKDKNTNEEKGFKDLLNIHFIELPKYKEYAVKHRNKMIDNYSWILFLNDPNDEYFKRDDIPEVFINAREQLFLLQADPDFIELYEQREKEIMDEKSKMEGKYDEGLIKGRKEGEKIGELKYLMKSLKKGEKLKEIKDDYKEIFTEEELEIINSFVEDKSYKIKDLALQLDLDEDIILEVCEKVNLDVQERKEKKRKIKIKYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.14
4 0.12
5 0.13
6 0.17
7 0.15
8 0.17
9 0.19
10 0.2
11 0.23
12 0.26
13 0.25
14 0.25
15 0.27
16 0.25
17 0.26
18 0.31
19 0.28
20 0.25
21 0.25
22 0.21
23 0.21
24 0.24
25 0.24
26 0.22
27 0.21
28 0.23
29 0.3
30 0.29
31 0.3
32 0.35
33 0.34
34 0.37
35 0.39
36 0.38
37 0.32
38 0.31
39 0.3
40 0.27
41 0.31
42 0.26
43 0.27
44 0.35
45 0.37
46 0.43
47 0.46
48 0.46
49 0.47
50 0.49
51 0.51
52 0.52
53 0.51
54 0.54
55 0.51
56 0.49
57 0.45
58 0.41
59 0.35
60 0.26
61 0.22
62 0.17
63 0.15
64 0.13
65 0.12
66 0.13
67 0.13
68 0.14
69 0.14
70 0.13
71 0.15
72 0.22
73 0.22
74 0.21
75 0.21
76 0.21
77 0.21
78 0.24
79 0.31
80 0.24
81 0.29
82 0.3
83 0.36
84 0.42
85 0.46
86 0.43
87 0.39
88 0.4
89 0.39
90 0.4
91 0.33
92 0.31
93 0.3
94 0.29
95 0.27
96 0.25
97 0.21
98 0.22
99 0.22
100 0.22
101 0.2
102 0.21
103 0.17
104 0.18
105 0.18
106 0.2
107 0.22
108 0.3
109 0.37
110 0.44
111 0.47
112 0.52
113 0.56
114 0.54
115 0.56
116 0.49
117 0.43
118 0.37
119 0.35
120 0.29
121 0.25
122 0.23
123 0.19
124 0.15
125 0.11
126 0.1
127 0.08
128 0.08
129 0.08
130 0.1
131 0.1
132 0.12
133 0.12
134 0.11
135 0.12
136 0.12
137 0.13
138 0.13
139 0.17
140 0.15
141 0.15
142 0.15
143 0.15
144 0.15
145 0.14
146 0.13
147 0.09
148 0.08
149 0.07
150 0.08
151 0.07
152 0.07
153 0.06
154 0.06
155 0.06
156 0.06
157 0.06
158 0.05
159 0.05
160 0.06
161 0.06
162 0.1
163 0.15
164 0.15
165 0.15
166 0.16
167 0.16
168 0.16
169 0.23
170 0.22
171 0.21
172 0.23
173 0.23
174 0.29
175 0.32
176 0.3
177 0.26
178 0.24
179 0.23
180 0.24
181 0.25
182 0.2
183 0.18
184 0.22
185 0.22
186 0.22
187 0.2
188 0.22
189 0.21
190 0.22
191 0.25
192 0.25
193 0.28
194 0.3
195 0.31
196 0.3
197 0.28
198 0.29
199 0.27
200 0.27
201 0.23
202 0.23
203 0.23
204 0.28
205 0.36
206 0.42
207 0.47
208 0.49
209 0.58
210 0.62
211 0.65
212 0.68
213 0.66
214 0.64
215 0.61
216 0.61
217 0.53
218 0.49
219 0.44
220 0.35
221 0.29
222 0.23
223 0.22
224 0.17
225 0.15
226 0.12
227 0.12
228 0.11
229 0.1
230 0.09
231 0.06
232 0.07
233 0.06
234 0.08
235 0.08
236 0.1
237 0.17
238 0.2
239 0.21
240 0.22
241 0.24
242 0.26
243 0.33
244 0.35
245 0.29
246 0.27
247 0.26
248 0.26
249 0.23
250 0.19
251 0.11
252 0.07
253 0.06
254 0.06
255 0.05
256 0.05
257 0.05
258 0.05
259 0.06
260 0.07
261 0.08
262 0.13
263 0.15
264 0.2
265 0.26
266 0.32
267 0.42
268 0.47
269 0.56
270 0.61
271 0.68
272 0.73
273 0.78
274 0.82