Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2BSM1

Protein Details
Accession A0A1Y2BSM1    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
80-113EIDSNEKKRQRARRRKIKKIERKQKEKELKGSIEBasic
NLS Segment(s)
PositionSequence
86-109KKRQRARRRKIKKIERKQKEKELK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012173  Mpp10  
Gene Ontology GO:0034457  C:Mpp10 complex  
GO:0005732  C:sno(s)RNA-containing ribonucleoprotein complex  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04006  Mpp10  
Amino Acid Sequences ELEKHHQEIDEFFKKLCLNLKGLSNWNSALKPAKMEMIVVSNVPSIQMDEVLPIHESENTLLAPEEAYEKPKADVKGETEIDSNEKKRQRARRRKIKKIERKQKEKELKGSIEDFAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.36
4 0.3
5 0.27
6 0.29
7 0.34
8 0.35
9 0.4
10 0.41
11 0.35
12 0.33
13 0.32
14 0.3
15 0.27
16 0.28
17 0.23
18 0.21
19 0.2
20 0.2
21 0.17
22 0.18
23 0.16
24 0.14
25 0.13
26 0.12
27 0.12
28 0.09
29 0.09
30 0.09
31 0.08
32 0.05
33 0.05
34 0.06
35 0.05
36 0.05
37 0.06
38 0.06
39 0.07
40 0.06
41 0.07
42 0.06
43 0.07
44 0.06
45 0.07
46 0.06
47 0.06
48 0.06
49 0.05
50 0.05
51 0.05
52 0.08
53 0.07
54 0.1
55 0.11
56 0.11
57 0.13
58 0.17
59 0.18
60 0.17
61 0.19
62 0.2
63 0.26
64 0.27
65 0.27
66 0.23
67 0.23
68 0.25
69 0.27
70 0.26
71 0.26
72 0.3
73 0.34
74 0.42
75 0.52
76 0.6
77 0.67
78 0.76
79 0.8
80 0.86
81 0.92
82 0.95
83 0.95
84 0.95
85 0.95
86 0.95
87 0.95
88 0.95
89 0.93
90 0.93
91 0.93
92 0.9
93 0.88
94 0.85
95 0.78
96 0.73
97 0.66