Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1XTQ9

Protein Details
Accession A0A1Y1XTQ9    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
68-92YVIKFNYFFYKKKKKKKKKKNLLFKHydrophilic
NLS Segment(s)
PositionSequence
78-90KKKKKKKKKKNLL
Subcellular Location(s) nucl 14.5, mito_nucl 13.5, mito 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004123  Dim1  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0046540  C:U4/U6 x U5 tri-snRNP complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF02966  DIM1  
Amino Acid Sequences MFFYRNKHIMIDLGTGNNNKINWALEDKQEMIDIIETVYRGARKGRGLVVSPKDYSTSTNIRFHFILYVIKFNYFFYKKKKKKKKKKNLLFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.22
4 0.22
5 0.19
6 0.16
7 0.16
8 0.15
9 0.14
10 0.19
11 0.2
12 0.2
13 0.23
14 0.23
15 0.22
16 0.21
17 0.19
18 0.13
19 0.12
20 0.09
21 0.06
22 0.06
23 0.06
24 0.06
25 0.07
26 0.07
27 0.07
28 0.09
29 0.11
30 0.12
31 0.14
32 0.16
33 0.17
34 0.19
35 0.25
36 0.28
37 0.28
38 0.27
39 0.25
40 0.24
41 0.23
42 0.22
43 0.21
44 0.23
45 0.25
46 0.3
47 0.31
48 0.32
49 0.32
50 0.31
51 0.28
52 0.22
53 0.23
54 0.18
55 0.22
56 0.2
57 0.21
58 0.21
59 0.21
60 0.28
61 0.27
62 0.3
63 0.36
64 0.47
65 0.56
66 0.67
67 0.77
68 0.8
69 0.88
70 0.94
71 0.96
72 0.96