Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2EMS6

Protein Details
Accession A0A1Y2EMS6    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
228-286SVDYAYERMKERRRRGKKNRVAIKDRNWVLHKKEVARKKGKTNVPKDSKYTGRKRKVRFBasic
NLS Segment(s)
PositionSequence
236-286MKERRRRGKKNRVAIKDRNWVLHKKEVARKKGKTNVPKDSKYTGRKRKVRF
Subcellular Location(s) nucl 15, cyto_nucl 13.5, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR039769  Bud23-like  
IPR022238  Bud23_C  
IPR013216  Methyltransf_11  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0016435  F:rRNA (guanine) methyltransferase activity  
GO:0070476  P:rRNA (guanine-N7)-methylation  
Pfam View protein in Pfam  
PF08241  Methyltransf_11  
PF12589  WBS_methylT  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MSRPEHQAPAEIVYNDSEAKKYTVNTRIQAIQADMSYRALELLNLPEDKCCYLLDIGCGSGLSSEVLEDEGHVWVGVDISPSMLEVAKERDIQGDMFLQDIGDGFGFRPGTFDGAISISVIQWLCNADKKYHNPKKRLTRFFSTLYSALARGARAVFQFYPENPDQVELIVGSAMKCGFTGGLVVDYPNSSKAKKFYLCLFAGFADNPSNAPSLPKGLGAENEEARSSVDYAYERMKERRRRGKKNRVAIKDRNWVLHKKEVARKKGKTNVPKDSKYTGRKRKVRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.21
4 0.18
5 0.16
6 0.17
7 0.19
8 0.2
9 0.27
10 0.33
11 0.39
12 0.4
13 0.43
14 0.44
15 0.43
16 0.43
17 0.36
18 0.3
19 0.24
20 0.23
21 0.2
22 0.17
23 0.15
24 0.13
25 0.12
26 0.1
27 0.1
28 0.1
29 0.12
30 0.15
31 0.16
32 0.16
33 0.17
34 0.19
35 0.19
36 0.18
37 0.15
38 0.13
39 0.14
40 0.15
41 0.16
42 0.15
43 0.15
44 0.14
45 0.13
46 0.11
47 0.09
48 0.08
49 0.06
50 0.05
51 0.04
52 0.04
53 0.05
54 0.05
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.05
62 0.06
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.06
70 0.06
71 0.06
72 0.06
73 0.1
74 0.12
75 0.14
76 0.14
77 0.15
78 0.16
79 0.15
80 0.15
81 0.14
82 0.11
83 0.11
84 0.1
85 0.08
86 0.07
87 0.07
88 0.06
89 0.04
90 0.04
91 0.04
92 0.06
93 0.07
94 0.07
95 0.08
96 0.08
97 0.09
98 0.09
99 0.09
100 0.08
101 0.08
102 0.08
103 0.07
104 0.07
105 0.05
106 0.07
107 0.07
108 0.06
109 0.06
110 0.07
111 0.08
112 0.12
113 0.14
114 0.15
115 0.21
116 0.28
117 0.39
118 0.48
119 0.55
120 0.56
121 0.64
122 0.72
123 0.77
124 0.78
125 0.73
126 0.7
127 0.67
128 0.63
129 0.57
130 0.49
131 0.39
132 0.31
133 0.25
134 0.19
135 0.15
136 0.13
137 0.1
138 0.08
139 0.08
140 0.08
141 0.08
142 0.1
143 0.09
144 0.11
145 0.12
146 0.12
147 0.18
148 0.17
149 0.18
150 0.15
151 0.16
152 0.14
153 0.12
154 0.12
155 0.06
156 0.05
157 0.05
158 0.05
159 0.04
160 0.05
161 0.05
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.05
168 0.04
169 0.05
170 0.05
171 0.05
172 0.05
173 0.06
174 0.07
175 0.1
176 0.11
177 0.11
178 0.14
179 0.16
180 0.23
181 0.26
182 0.28
183 0.3
184 0.36
185 0.36
186 0.34
187 0.33
188 0.26
189 0.25
190 0.23
191 0.19
192 0.13
193 0.12
194 0.12
195 0.12
196 0.12
197 0.1
198 0.11
199 0.11
200 0.12
201 0.13
202 0.14
203 0.14
204 0.14
205 0.17
206 0.19
207 0.21
208 0.2
209 0.2
210 0.19
211 0.18
212 0.18
213 0.16
214 0.14
215 0.1
216 0.11
217 0.11
218 0.13
219 0.18
220 0.21
221 0.24
222 0.31
223 0.4
224 0.48
225 0.57
226 0.67
227 0.73
228 0.81
229 0.88
230 0.92
231 0.92
232 0.93
233 0.93
234 0.92
235 0.9
236 0.88
237 0.86
238 0.85
239 0.78
240 0.75
241 0.7
242 0.67
243 0.63
244 0.62
245 0.59
246 0.58
247 0.64
248 0.65
249 0.71
250 0.74
251 0.75
252 0.77
253 0.8
254 0.81
255 0.82
256 0.83
257 0.83
258 0.83
259 0.82
260 0.78
261 0.76
262 0.76
263 0.76
264 0.77
265 0.77
266 0.78