Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2E7S7

Protein Details
Accession A0A1Y2E7S7    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
134-160KMKMKMKMKVKMKMKKKNENENENENEHydrophilic
NLS Segment(s)
PositionSequence
77-115KMKMKMKMKMKMKMKMKMKMKMKMKMKMKMKMKMKMKMK
131-150KKMKMKMKMKMKVKMKMKKK
Subcellular Location(s) nucl 13.5, mito 9, cyto_nucl 9, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MKSIIPSIKYLALEKQISLYIILECIYKEIDIVKKNENENENENENENENENENENENENENENENENENENEMKMKMKMKMKMKMKMKMKMKMKMKMKMKMKMKMKMKMKMKMKENENENENENENENEKKMKMKMKMKMKVKMKMKKKNENENENENENESENESESENENENENENENENENENEMKVKVKVEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.25
4 0.24
5 0.22
6 0.19
7 0.12
8 0.11
9 0.12
10 0.1
11 0.09
12 0.09
13 0.09
14 0.08
15 0.08
16 0.11
17 0.17
18 0.21
19 0.25
20 0.3
21 0.35
22 0.38
23 0.44
24 0.43
25 0.41
26 0.41
27 0.43
28 0.4
29 0.36
30 0.35
31 0.3
32 0.28
33 0.25
34 0.22
35 0.18
36 0.16
37 0.16
38 0.16
39 0.16
40 0.16
41 0.16
42 0.16
43 0.16
44 0.16
45 0.16
46 0.16
47 0.16
48 0.16
49 0.16
50 0.16
51 0.16
52 0.16
53 0.16
54 0.16
55 0.15
56 0.15
57 0.14
58 0.12
59 0.12
60 0.1
61 0.11
62 0.11
63 0.15
64 0.19
65 0.25
66 0.31
67 0.38
68 0.46
69 0.51
70 0.57
71 0.61
72 0.64
73 0.65
74 0.67
75 0.67
76 0.67
77 0.67
78 0.67
79 0.67
80 0.67
81 0.67
82 0.67
83 0.67
84 0.67
85 0.67
86 0.67
87 0.67
88 0.67
89 0.67
90 0.67
91 0.67
92 0.67
93 0.67
94 0.67
95 0.67
96 0.67
97 0.68
98 0.67
99 0.68
100 0.67
101 0.64
102 0.62
103 0.6
104 0.56
105 0.5
106 0.45
107 0.39
108 0.34
109 0.3
110 0.25
111 0.22
112 0.19
113 0.18
114 0.17
115 0.16
116 0.16
117 0.15
118 0.18
119 0.21
120 0.27
121 0.34
122 0.41
123 0.49
124 0.57
125 0.65
126 0.69
127 0.73
128 0.74
129 0.74
130 0.76
131 0.77
132 0.77
133 0.79
134 0.81
135 0.83
136 0.84
137 0.87
138 0.87
139 0.87
140 0.83
141 0.8
142 0.75
143 0.68
144 0.59
145 0.5
146 0.41
147 0.32
148 0.27
149 0.2
150 0.16
151 0.14
152 0.14
153 0.13
154 0.14
155 0.15
156 0.16
157 0.17
158 0.17
159 0.17
160 0.17
161 0.19
162 0.19
163 0.19
164 0.17
165 0.16
166 0.17
167 0.17
168 0.17
169 0.17
170 0.15
171 0.15
172 0.15
173 0.13
174 0.15
175 0.14
176 0.16
177 0.16