Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2C0B9

Protein Details
Accession A0A1Y2C0B9    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-33NLGNTYKGKIIKKKRKLIEKSKVKNRYYKTHydrophilic
67-99EENLEKKKEYYRNRKSTRHKLARKNSRGQPIMKHydrophilic
NLS Segment(s)
PositionSequence
10-27KGKIIKKKRKLIEKSKVK
54-93KEEKEKNEKERIKEENLEKKKEYYRNRKSTRHKLARKNSR
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013730  Fyv7/TAP26  
Pfam View protein in Pfam  
PF08524  rRNA_processing  
Amino Acid Sequences MNRNLGNTYKGKIIKKKRKLIEKSKVKNRYYKTIQNEEDDTPDYIKEIFATDKKEEKEKNEKERIKEENLEKKKEYYRNRKSTRHKLARKNSRGQPIMKNQLEYLLSKLEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.72
3 0.79
4 0.81
5 0.85
6 0.88
7 0.89
8 0.89
9 0.89
10 0.89
11 0.9
12 0.9
13 0.84
14 0.82
15 0.76
16 0.75
17 0.72
18 0.7
19 0.67
20 0.67
21 0.65
22 0.61
23 0.59
24 0.49
25 0.44
26 0.37
27 0.3
28 0.21
29 0.18
30 0.14
31 0.11
32 0.1
33 0.08
34 0.07
35 0.08
36 0.1
37 0.14
38 0.16
39 0.2
40 0.22
41 0.27
42 0.28
43 0.32
44 0.41
45 0.45
46 0.52
47 0.57
48 0.61
49 0.59
50 0.64
51 0.62
52 0.56
53 0.55
54 0.53
55 0.54
56 0.55
57 0.56
58 0.51
59 0.51
60 0.54
61 0.56
62 0.59
63 0.6
64 0.64
65 0.71
66 0.78
67 0.83
68 0.86
69 0.88
70 0.89
71 0.89
72 0.88
73 0.88
74 0.9
75 0.92
76 0.9
77 0.89
78 0.85
79 0.84
80 0.8
81 0.75
82 0.73
83 0.72
84 0.74
85 0.67
86 0.61
87 0.51
88 0.51
89 0.47
90 0.39
91 0.32