Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2D260

Protein Details
Accession A0A1Y2D260   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
27-53SSSYNTTKKKTTKKTTTTKKTKKISTSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 12.5, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001002  Chitin-bd_1  
IPR018371  Chitin-binding_1_CS  
IPR036861  Endochitinase-like_sf  
Gene Ontology GO:0008061  F:chitin binding  
Pfam View protein in Pfam  
PF00187  Chitin_bind_1  
PROSITE View protein in PROSITE  
PS00026  CHIT_BIND_I_1  
PS50941  CHIT_BIND_I_2  
Amino Acid Sequences CCSMYGYCGKSSKYCKEGYQSEFGHCSSSYNTTKKKTTKKTTTTKKTKKISTSFVSGRCGSKYGKCSKSNECCSKYGYCGKSSDYCDNGCQPAYGICY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.46
3 0.51
4 0.56
5 0.54
6 0.54
7 0.48
8 0.46
9 0.44
10 0.4
11 0.35
12 0.27
13 0.24
14 0.17
15 0.23
16 0.26
17 0.3
18 0.35
19 0.37
20 0.45
21 0.51
22 0.59
23 0.63
24 0.68
25 0.71
26 0.75
27 0.81
28 0.85
29 0.88
30 0.89
31 0.88
32 0.87
33 0.84
34 0.81
35 0.78
36 0.72
37 0.68
38 0.6
39 0.57
40 0.51
41 0.46
42 0.44
43 0.38
44 0.34
45 0.28
46 0.27
47 0.22
48 0.23
49 0.28
50 0.34
51 0.4
52 0.43
53 0.48
54 0.55
55 0.63
56 0.69
57 0.71
58 0.66
59 0.6
60 0.59
61 0.56
62 0.53
63 0.52
64 0.44
65 0.38
66 0.36
67 0.38
68 0.41
69 0.44
70 0.45
71 0.4
72 0.39
73 0.4
74 0.41
75 0.4
76 0.34
77 0.29
78 0.23