Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2DDK9

Protein Details
Accession A0A1Y2DDK9   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
77-106CSKYSLKKISNEKKKNIRKNNRNNFKINIDHydrophilic
NLS Segment(s)
PositionSequence
89-92KKKN
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010422  Ccdc124/Oxs1  
Pfam View protein in Pfam  
PF06244  Ccdc124  
Amino Acid Sequences MAYYGNNVYNEKSYKVANLINIPKAYKFFKQRKLEEYEASNKIYSKSELEKHIQRAWKNSPENPLNQISIKENIEICSKYSLKKISNEKKKNIRKNNRNNFKINIDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.26
4 0.24
5 0.3
6 0.33
7 0.35
8 0.36
9 0.35
10 0.32
11 0.33
12 0.33
13 0.32
14 0.37
15 0.42
16 0.5
17 0.58
18 0.62
19 0.65
20 0.69
21 0.66
22 0.6
23 0.56
24 0.53
25 0.46
26 0.42
27 0.37
28 0.29
29 0.27
30 0.25
31 0.21
32 0.17
33 0.19
34 0.21
35 0.24
36 0.28
37 0.31
38 0.34
39 0.37
40 0.38
41 0.35
42 0.38
43 0.4
44 0.44
45 0.43
46 0.41
47 0.44
48 0.43
49 0.44
50 0.41
51 0.38
52 0.31
53 0.28
54 0.27
55 0.22
56 0.23
57 0.21
58 0.19
59 0.17
60 0.17
61 0.2
62 0.19
63 0.18
64 0.21
65 0.21
66 0.21
67 0.26
68 0.31
69 0.31
70 0.39
71 0.49
72 0.53
73 0.64
74 0.71
75 0.75
76 0.79
77 0.86
78 0.89
79 0.9
80 0.9
81 0.9
82 0.93
83 0.95
84 0.95
85 0.91
86 0.86
87 0.81