Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1ZME8

Protein Details
Accession A0A1Y1ZME8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
169-195TNNNNKKESNNKKENNNKKENNNKEENHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002068  A-crystallin/Hsp20_dom  
IPR008978  HSP20-like_chaperone  
IPR031107  Small_HSP  
Pfam View protein in Pfam  
PF00011  HSP20  
PROSITE View protein in PROSITE  
PS01031  SHSP  
CDD cd06464  ACD_sHsps-like  
Amino Acid Sequences MSLFIREYPLSIRRNSSLLRDSFFNDIENDLENELLNHPLITFPSLYPYPYLSYNPVKNLEDQISKTFNSNVLKSIDFSPKINLSEDENNYYIHADLPGMNKDQVKMELSDDDRVLTISGEREIIIDDSDKNYKKDSNNDANKDSIKDENSKKDANENKETINEEQKETNNNNKKESNNKKENNNKKENNNKEENNKKYSRIECSYGKFSRSFSIPENADINNIQAKMENGVLEVTLKKMEPQKNEYKHSIQIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.41
4 0.41
5 0.4
6 0.39
7 0.37
8 0.37
9 0.36
10 0.35
11 0.29
12 0.22
13 0.2
14 0.19
15 0.19
16 0.17
17 0.13
18 0.13
19 0.11
20 0.11
21 0.11
22 0.11
23 0.09
24 0.08
25 0.08
26 0.09
27 0.09
28 0.1
29 0.1
30 0.09
31 0.15
32 0.15
33 0.16
34 0.16
35 0.17
36 0.18
37 0.19
38 0.21
39 0.21
40 0.28
41 0.3
42 0.33
43 0.36
44 0.35
45 0.35
46 0.37
47 0.36
48 0.32
49 0.31
50 0.32
51 0.3
52 0.29
53 0.28
54 0.26
55 0.26
56 0.25
57 0.24
58 0.23
59 0.23
60 0.23
61 0.23
62 0.26
63 0.28
64 0.25
65 0.25
66 0.26
67 0.26
68 0.27
69 0.27
70 0.23
71 0.22
72 0.27
73 0.28
74 0.28
75 0.26
76 0.25
77 0.24
78 0.23
79 0.18
80 0.12
81 0.1
82 0.07
83 0.08
84 0.1
85 0.12
86 0.13
87 0.14
88 0.14
89 0.15
90 0.16
91 0.15
92 0.14
93 0.13
94 0.13
95 0.15
96 0.16
97 0.17
98 0.16
99 0.14
100 0.13
101 0.12
102 0.11
103 0.07
104 0.07
105 0.05
106 0.06
107 0.06
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.07
116 0.12
117 0.14
118 0.14
119 0.15
120 0.19
121 0.21
122 0.28
123 0.35
124 0.4
125 0.47
126 0.5
127 0.5
128 0.48
129 0.47
130 0.41
131 0.34
132 0.27
133 0.21
134 0.24
135 0.27
136 0.31
137 0.34
138 0.35
139 0.33
140 0.39
141 0.44
142 0.44
143 0.46
144 0.4
145 0.38
146 0.39
147 0.41
148 0.35
149 0.36
150 0.31
151 0.26
152 0.28
153 0.28
154 0.31
155 0.32
156 0.4
157 0.41
158 0.42
159 0.45
160 0.46
161 0.49
162 0.54
163 0.62
164 0.62
165 0.63
166 0.66
167 0.71
168 0.78
169 0.84
170 0.83
171 0.83
172 0.79
173 0.79
174 0.84
175 0.84
176 0.81
177 0.79
178 0.74
179 0.74
180 0.77
181 0.73
182 0.71
183 0.64
184 0.61
185 0.6
186 0.59
187 0.58
188 0.53
189 0.52
190 0.5
191 0.53
192 0.57
193 0.52
194 0.51
195 0.44
196 0.4
197 0.39
198 0.35
199 0.33
200 0.27
201 0.33
202 0.31
203 0.32
204 0.33
205 0.29
206 0.29
207 0.26
208 0.24
209 0.2
210 0.19
211 0.16
212 0.15
213 0.16
214 0.16
215 0.17
216 0.15
217 0.11
218 0.11
219 0.11
220 0.12
221 0.12
222 0.11
223 0.11
224 0.11
225 0.16
226 0.24
227 0.31
228 0.36
229 0.44
230 0.53
231 0.6
232 0.67
233 0.69
234 0.65