Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2CB33

Protein Details
Accession A0A1Y2CB33    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
50-70IGYPCCKKKNGKIYKVNSYGSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, cyto 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002883  CBM10/Dockerin_dom  
IPR009034  Dockerin_dom_fun_sf  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF02013  CBM_10  
PROSITE View protein in PROSITE  
PS51763  CBM10  
Amino Acid Sequences CWSEELGFLCCKESKTKVKLEDINGKWGKEKGRWCGIIEELDDGCWASKIGYPCCKKKNGKIYKVNSYGSWGIEKSNWCGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.4
3 0.48
4 0.5
5 0.57
6 0.61
7 0.62
8 0.65
9 0.57
10 0.62
11 0.56
12 0.51
13 0.45
14 0.42
15 0.38
16 0.34
17 0.37
18 0.34
19 0.39
20 0.4
21 0.39
22 0.38
23 0.36
24 0.32
25 0.26
26 0.22
27 0.14
28 0.12
29 0.11
30 0.09
31 0.07
32 0.06
33 0.05
34 0.04
35 0.07
36 0.11
37 0.15
38 0.24
39 0.29
40 0.37
41 0.43
42 0.51
43 0.55
44 0.61
45 0.67
46 0.69
47 0.74
48 0.77
49 0.79
50 0.8
51 0.8
52 0.73
53 0.63
54 0.58
55 0.49
56 0.41
57 0.37
58 0.27
59 0.22
60 0.24
61 0.26