Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2AE87

Protein Details
Accession A0A1Y2AE87   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
108-133SAILRSKKPAKTIKKREQKGVRKVRAHydrophilic
NLS Segment(s)
PositionSequence
102-133AAAARVSAILRSKKPAKTIKKREQKGVRKVRA
Subcellular Location(s) nucl 13mito 13mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR029004  L28e/Mak16  
IPR002672  Ribosomal_L28e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01778  Ribosomal_L28e  
Amino Acid Sequences MSADLVWQIVKNNNAYLVKKSGVQFSSEPGNLMNVNSFKYSGIANNKSVIIGSTEKGVSFATTKASNKNLKTSSVELKKGARPSAAAVKNVLKGYRPDLSKAAAARVSAILRSKKPAKTIKKREQKGVRKVRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.32
4 0.32
5 0.3
6 0.32
7 0.33
8 0.34
9 0.3
10 0.31
11 0.28
12 0.26
13 0.31
14 0.27
15 0.26
16 0.19
17 0.21
18 0.17
19 0.17
20 0.18
21 0.12
22 0.14
23 0.14
24 0.14
25 0.12
26 0.13
27 0.13
28 0.15
29 0.22
30 0.24
31 0.24
32 0.25
33 0.25
34 0.24
35 0.23
36 0.18
37 0.13
38 0.11
39 0.1
40 0.1
41 0.11
42 0.1
43 0.11
44 0.11
45 0.08
46 0.08
47 0.08
48 0.09
49 0.11
50 0.12
51 0.15
52 0.21
53 0.25
54 0.25
55 0.31
56 0.3
57 0.3
58 0.32
59 0.32
60 0.35
61 0.35
62 0.36
63 0.32
64 0.34
65 0.36
66 0.36
67 0.34
68 0.26
69 0.21
70 0.23
71 0.3
72 0.3
73 0.26
74 0.25
75 0.27
76 0.3
77 0.31
78 0.28
79 0.2
80 0.19
81 0.22
82 0.26
83 0.25
84 0.24
85 0.24
86 0.26
87 0.28
88 0.27
89 0.26
90 0.22
91 0.2
92 0.19
93 0.19
94 0.18
95 0.17
96 0.22
97 0.24
98 0.24
99 0.32
100 0.38
101 0.4
102 0.48
103 0.55
104 0.61
105 0.67
106 0.76
107 0.8
108 0.83
109 0.86
110 0.88
111 0.89
112 0.89
113 0.88