Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2ES98

Protein Details
Accession A0A1Y2ES98   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-26VEGHYHRSSNTRRKSNKGLFDDHydrophilic
328-354YKIQEFCRKKLSNKVQHNSLNRNKQQKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR016137  RGS  
IPR036305  RGS_sf  
IPR044926  RGS_subdomain_2  
Pfam View protein in Pfam  
PF00615  RGS  
Amino Acid Sequences MKTAVEGHYHRSSNTRRKSNKGLFDDLVLYEARDGASRQKLISHFGVDCAIRTGAGSRLKVETIYGGSHADVATRRRKSDSSIHHWSQDLNSPLLNENINSPLLNDNLPSPVSGSSSNYGYGHRRHNDSLDRIVQPVMVQKLYDFFGNDAAIDIPFEEIEKNGIGYLIQSSVPLAFFILYLLIHDNPEIIFFFLDVIKFEETIYPDNNSSLEASQNILTNYLCINSPLECNVSSKARCQCIKAIKAGQRRCFKASKQELLPVLERQFEDFKNSKRYAELRANYAHLNAYPESNRLELIQELLSTTNRKYPIETAENSQRANRNRAVLYKIQEFCRKKLSNKVQHNSLNRNKQQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.65
3 0.65
4 0.72
5 0.82
6 0.83
7 0.83
8 0.8
9 0.77
10 0.67
11 0.63
12 0.57
13 0.46
14 0.38
15 0.28
16 0.21
17 0.13
18 0.13
19 0.1
20 0.09
21 0.1
22 0.16
23 0.23
24 0.24
25 0.24
26 0.29
27 0.31
28 0.35
29 0.37
30 0.34
31 0.27
32 0.27
33 0.3
34 0.24
35 0.23
36 0.21
37 0.18
38 0.13
39 0.13
40 0.14
41 0.16
42 0.22
43 0.22
44 0.21
45 0.23
46 0.24
47 0.24
48 0.22
49 0.18
50 0.15
51 0.15
52 0.14
53 0.13
54 0.12
55 0.13
56 0.12
57 0.12
58 0.14
59 0.19
60 0.27
61 0.29
62 0.32
63 0.35
64 0.36
65 0.39
66 0.45
67 0.49
68 0.49
69 0.55
70 0.55
71 0.53
72 0.53
73 0.49
74 0.42
75 0.39
76 0.32
77 0.24
78 0.22
79 0.2
80 0.21
81 0.21
82 0.19
83 0.13
84 0.12
85 0.13
86 0.13
87 0.12
88 0.12
89 0.12
90 0.13
91 0.13
92 0.11
93 0.1
94 0.11
95 0.11
96 0.1
97 0.1
98 0.09
99 0.11
100 0.11
101 0.13
102 0.13
103 0.13
104 0.15
105 0.14
106 0.16
107 0.19
108 0.22
109 0.28
110 0.3
111 0.34
112 0.34
113 0.39
114 0.43
115 0.43
116 0.44
117 0.4
118 0.37
119 0.34
120 0.32
121 0.27
122 0.21
123 0.21
124 0.17
125 0.13
126 0.12
127 0.11
128 0.12
129 0.13
130 0.13
131 0.09
132 0.08
133 0.09
134 0.09
135 0.09
136 0.08
137 0.07
138 0.07
139 0.06
140 0.06
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.05
147 0.05
148 0.05
149 0.05
150 0.05
151 0.04
152 0.04
153 0.05
154 0.05
155 0.05
156 0.05
157 0.05
158 0.05
159 0.05
160 0.05
161 0.05
162 0.04
163 0.04
164 0.04
165 0.04
166 0.03
167 0.04
168 0.05
169 0.05
170 0.05
171 0.05
172 0.06
173 0.05
174 0.06
175 0.06
176 0.05
177 0.04
178 0.04
179 0.05
180 0.05
181 0.06
182 0.06
183 0.07
184 0.07
185 0.08
186 0.08
187 0.09
188 0.1
189 0.12
190 0.13
191 0.12
192 0.12
193 0.13
194 0.13
195 0.11
196 0.11
197 0.09
198 0.09
199 0.08
200 0.09
201 0.09
202 0.11
203 0.1
204 0.1
205 0.1
206 0.09
207 0.09
208 0.09
209 0.08
210 0.07
211 0.08
212 0.08
213 0.09
214 0.09
215 0.11
216 0.11
217 0.13
218 0.14
219 0.19
220 0.19
221 0.25
222 0.29
223 0.34
224 0.35
225 0.37
226 0.42
227 0.45
228 0.48
229 0.48
230 0.5
231 0.51
232 0.59
233 0.64
234 0.65
235 0.64
236 0.64
237 0.63
238 0.61
239 0.56
240 0.58
241 0.59
242 0.58
243 0.53
244 0.55
245 0.53
246 0.5
247 0.5
248 0.43
249 0.35
250 0.31
251 0.28
252 0.25
253 0.26
254 0.23
255 0.28
256 0.29
257 0.33
258 0.39
259 0.41
260 0.39
261 0.4
262 0.43
263 0.43
264 0.48
265 0.46
266 0.42
267 0.43
268 0.44
269 0.4
270 0.38
271 0.31
272 0.22
273 0.23
274 0.18
275 0.19
276 0.18
277 0.19
278 0.2
279 0.19
280 0.19
281 0.16
282 0.17
283 0.14
284 0.15
285 0.13
286 0.11
287 0.12
288 0.13
289 0.14
290 0.15
291 0.16
292 0.19
293 0.22
294 0.22
295 0.24
296 0.27
297 0.33
298 0.38
299 0.39
300 0.41
301 0.48
302 0.51
303 0.5
304 0.51
305 0.5
306 0.49
307 0.53
308 0.51
309 0.47
310 0.47
311 0.51
312 0.52
313 0.51
314 0.51
315 0.53
316 0.53
317 0.53
318 0.59
319 0.59
320 0.57
321 0.61
322 0.61
323 0.57
324 0.64
325 0.69
326 0.69
327 0.76
328 0.8
329 0.79
330 0.82
331 0.85
332 0.84
333 0.83
334 0.84