Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2E8W6

Protein Details
Accession A0A1Y2E8W6    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
25-47DINISRPPKIYKKKSVNVNQDISHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 13.5, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR029239  CFAP418  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0001917  C:photoreceptor inner segment  
Pfam View protein in Pfam  
PF14996  RMP  
Amino Acid Sequences MSSLHKSDVNDDIESLIKELELEQDINISRPPKIYKKKSVNVNQDISIPNNNSNNNNNNNNISNNKPLETKKTNNNTTNTINDELNDILQELSEIDSPQISNRKSSRPSNIYTEEEKSSLINEKKIVNSNISNTTLLDDKSTLNKQTTSHEVPSSIRKAKCTTLCIGGQEGITIGNNQKSCSKLRCTSCDFNCMYFKDYKWSNKVDYLFFRNYVPNVEKLSEELIPKKGHTSICCQCTWLTVDKTTPISSIKDKKIKWSYPYQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.21
3 0.14
4 0.1
5 0.1
6 0.1
7 0.12
8 0.12
9 0.12
10 0.11
11 0.15
12 0.16
13 0.17
14 0.19
15 0.17
16 0.17
17 0.21
18 0.28
19 0.34
20 0.45
21 0.53
22 0.61
23 0.7
24 0.76
25 0.82
26 0.86
27 0.86
28 0.83
29 0.78
30 0.68
31 0.62
32 0.56
33 0.48
34 0.43
35 0.35
36 0.31
37 0.31
38 0.33
39 0.33
40 0.37
41 0.41
42 0.43
43 0.45
44 0.43
45 0.42
46 0.42
47 0.41
48 0.39
49 0.35
50 0.36
51 0.33
52 0.32
53 0.33
54 0.33
55 0.39
56 0.42
57 0.44
58 0.47
59 0.55
60 0.62
61 0.63
62 0.64
63 0.6
64 0.57
65 0.54
66 0.48
67 0.41
68 0.32
69 0.26
70 0.25
71 0.2
72 0.16
73 0.13
74 0.09
75 0.07
76 0.06
77 0.06
78 0.04
79 0.05
80 0.06
81 0.06
82 0.06
83 0.06
84 0.06
85 0.09
86 0.15
87 0.15
88 0.2
89 0.23
90 0.29
91 0.34
92 0.39
93 0.45
94 0.44
95 0.47
96 0.47
97 0.49
98 0.47
99 0.44
100 0.42
101 0.34
102 0.3
103 0.27
104 0.2
105 0.17
106 0.2
107 0.18
108 0.17
109 0.18
110 0.19
111 0.21
112 0.25
113 0.25
114 0.22
115 0.22
116 0.23
117 0.24
118 0.24
119 0.22
120 0.17
121 0.17
122 0.15
123 0.14
124 0.12
125 0.09
126 0.08
127 0.12
128 0.14
129 0.15
130 0.15
131 0.17
132 0.17
133 0.19
134 0.25
135 0.25
136 0.26
137 0.24
138 0.25
139 0.25
140 0.3
141 0.32
142 0.33
143 0.29
144 0.3
145 0.32
146 0.37
147 0.39
148 0.37
149 0.33
150 0.31
151 0.31
152 0.3
153 0.28
154 0.23
155 0.19
156 0.15
157 0.13
158 0.08
159 0.07
160 0.07
161 0.08
162 0.11
163 0.11
164 0.12
165 0.15
166 0.17
167 0.21
168 0.26
169 0.31
170 0.35
171 0.4
172 0.46
173 0.52
174 0.58
175 0.56
176 0.58
177 0.53
178 0.49
179 0.47
180 0.42
181 0.38
182 0.32
183 0.3
184 0.3
185 0.35
186 0.38
187 0.39
188 0.42
189 0.42
190 0.45
191 0.47
192 0.45
193 0.45
194 0.44
195 0.42
196 0.38
197 0.37
198 0.34
199 0.32
200 0.33
201 0.3
202 0.27
203 0.27
204 0.27
205 0.25
206 0.24
207 0.26
208 0.23
209 0.23
210 0.23
211 0.25
212 0.25
213 0.26
214 0.27
215 0.29
216 0.31
217 0.31
218 0.37
219 0.39
220 0.43
221 0.42
222 0.41
223 0.36
224 0.35
225 0.36
226 0.35
227 0.3
228 0.29
229 0.31
230 0.33
231 0.36
232 0.33
233 0.32
234 0.27
235 0.28
236 0.34
237 0.41
238 0.47
239 0.53
240 0.53
241 0.62
242 0.69
243 0.72
244 0.69