Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2ADQ6

Protein Details
Accession A0A1Y2ADQ6    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
57-81LFPNYKFKNNKGKNKYKYNKYSLIKHydrophilic
NLS Segment(s)
PositionSequence
84-86KPK
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MIYRKRNLHLILEKHKEIKTQNEVNILIGKIWKDEKETIKNEYKFKAEIHKLIHSYLFPNYKFKNNKGKNKYKYNKYSLIKGLKPKESQSKILERKIILHKNLIHKIKNTRKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.59
3 0.54
4 0.49
5 0.49
6 0.48
7 0.47
8 0.47
9 0.48
10 0.47
11 0.43
12 0.43
13 0.34
14 0.26
15 0.2
16 0.17
17 0.14
18 0.16
19 0.15
20 0.16
21 0.22
22 0.28
23 0.35
24 0.37
25 0.41
26 0.48
27 0.52
28 0.51
29 0.48
30 0.43
31 0.36
32 0.35
33 0.38
34 0.32
35 0.32
36 0.32
37 0.34
38 0.32
39 0.31
40 0.31
41 0.22
42 0.2
43 0.2
44 0.2
45 0.17
46 0.21
47 0.22
48 0.3
49 0.33
50 0.38
51 0.46
52 0.5
53 0.6
54 0.65
55 0.74
56 0.75
57 0.82
58 0.85
59 0.84
60 0.84
61 0.81
62 0.8
63 0.72
64 0.71
65 0.68
66 0.66
67 0.61
68 0.6
69 0.6
70 0.57
71 0.58
72 0.56
73 0.59
74 0.56
75 0.57
76 0.55
77 0.59
78 0.6
79 0.62
80 0.62
81 0.52
82 0.55
83 0.59
84 0.6
85 0.52
86 0.52
87 0.52
88 0.57
89 0.65
90 0.65
91 0.6
92 0.58
93 0.67