Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2C393

Protein Details
Accession A0A1Y2C393    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
75-101EFETAKITKRNRRKSKSRSRENSNDSLHydrophilic
NLS Segment(s)
PositionSequence
82-94TKRNRRKSKSRSR
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences LSDPLGEYRKFIANLRNKEINEVDDFIDIPINLVDLTANLITSLITGENCLYESINESDKRIKTLNIINEDSETEFETAKITKRNRRKSKSRSRENSNDSLSKEKKLNNLKSNSNLIPLKKNKSNSFNFEEYIQQENEESFYFIRKIIKKTQLSLTTFIEEIQYNKNNMEINKGQLPNIEISPHSDTNNNSLFLLNSGTNVITSPILKSGFLSSFQPRRQSSNISICSSIDSKIALDSNSQNTKIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.55
3 0.59
4 0.53
5 0.57
6 0.56
7 0.49
8 0.43
9 0.37
10 0.31
11 0.24
12 0.24
13 0.19
14 0.18
15 0.14
16 0.11
17 0.09
18 0.08
19 0.07
20 0.07
21 0.06
22 0.05
23 0.07
24 0.07
25 0.07
26 0.06
27 0.06
28 0.06
29 0.06
30 0.07
31 0.05
32 0.05
33 0.06
34 0.06
35 0.07
36 0.08
37 0.08
38 0.07
39 0.07
40 0.11
41 0.12
42 0.17
43 0.18
44 0.19
45 0.26
46 0.27
47 0.3
48 0.28
49 0.27
50 0.26
51 0.32
52 0.37
53 0.36
54 0.37
55 0.34
56 0.33
57 0.33
58 0.29
59 0.23
60 0.17
61 0.12
62 0.1
63 0.1
64 0.1
65 0.11
66 0.13
67 0.19
68 0.24
69 0.33
70 0.43
71 0.55
72 0.64
73 0.72
74 0.8
75 0.84
76 0.89
77 0.91
78 0.92
79 0.9
80 0.88
81 0.88
82 0.84
83 0.8
84 0.73
85 0.65
86 0.56
87 0.55
88 0.48
89 0.41
90 0.38
91 0.34
92 0.37
93 0.43
94 0.5
95 0.5
96 0.53
97 0.53
98 0.53
99 0.55
100 0.48
101 0.43
102 0.37
103 0.31
104 0.34
105 0.36
106 0.38
107 0.37
108 0.42
109 0.41
110 0.47
111 0.49
112 0.47
113 0.48
114 0.44
115 0.4
116 0.36
117 0.33
118 0.28
119 0.26
120 0.21
121 0.15
122 0.13
123 0.13
124 0.13
125 0.11
126 0.09
127 0.06
128 0.08
129 0.08
130 0.1
131 0.16
132 0.19
133 0.23
134 0.3
135 0.39
136 0.4
137 0.43
138 0.49
139 0.49
140 0.48
141 0.47
142 0.41
143 0.33
144 0.31
145 0.28
146 0.22
147 0.15
148 0.14
149 0.17
150 0.18
151 0.17
152 0.17
153 0.2
154 0.21
155 0.21
156 0.26
157 0.22
158 0.23
159 0.29
160 0.3
161 0.28
162 0.27
163 0.28
164 0.23
165 0.22
166 0.19
167 0.12
168 0.16
169 0.22
170 0.22
171 0.21
172 0.22
173 0.23
174 0.27
175 0.3
176 0.27
177 0.21
178 0.2
179 0.19
180 0.17
181 0.19
182 0.13
183 0.1
184 0.1
185 0.1
186 0.09
187 0.09
188 0.1
189 0.08
190 0.09
191 0.09
192 0.12
193 0.13
194 0.13
195 0.13
196 0.16
197 0.17
198 0.18
199 0.21
200 0.26
201 0.33
202 0.37
203 0.45
204 0.43
205 0.48
206 0.5
207 0.53
208 0.54
209 0.56
210 0.58
211 0.53
212 0.52
213 0.46
214 0.46
215 0.4
216 0.32
217 0.23
218 0.18
219 0.15
220 0.17
221 0.18
222 0.15
223 0.18
224 0.21
225 0.29
226 0.34