Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2BTT9

Protein Details
Accession A0A1Y2BTT9    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
86-114DESKQEKEKEKERKEKKGKGKDEEKDKEKBasic
117-140NEEEEKKKEKKGKGKNEKKRKRKRBasic
NLS Segment(s)
PositionSequence
91-140EKEKEKERKEKKGKGKDEEKDKEKDENEEEEKKKEKKGKGKNEKKRKRKR
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MKIDENLNKNIYTILLKFYENQDDLQLSYYTYETVMDKKEVISLYKSQNYIDNLKETLEGMKGLQIYEHIESFNSKYIRRILYKDDESKQEKEKEKERKEKKGKGKDEEKDKEKDENEEEEKKKEKKGKGKNEKKRKRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.18
4 0.2
5 0.23
6 0.28
7 0.25
8 0.25
9 0.23
10 0.22
11 0.22
12 0.23
13 0.19
14 0.13
15 0.13
16 0.12
17 0.1
18 0.09
19 0.1
20 0.09
21 0.11
22 0.13
23 0.13
24 0.13
25 0.13
26 0.16
27 0.16
28 0.17
29 0.17
30 0.2
31 0.24
32 0.28
33 0.28
34 0.26
35 0.29
36 0.31
37 0.31
38 0.28
39 0.24
40 0.2
41 0.2
42 0.2
43 0.16
44 0.14
45 0.11
46 0.09
47 0.07
48 0.08
49 0.08
50 0.08
51 0.07
52 0.07
53 0.08
54 0.09
55 0.09
56 0.07
57 0.07
58 0.08
59 0.09
60 0.14
61 0.14
62 0.13
63 0.15
64 0.2
65 0.24
66 0.25
67 0.27
68 0.27
69 0.34
70 0.39
71 0.43
72 0.41
73 0.44
74 0.46
75 0.47
76 0.47
77 0.48
78 0.49
79 0.49
80 0.55
81 0.59
82 0.64
83 0.72
84 0.74
85 0.78
86 0.81
87 0.85
88 0.87
89 0.87
90 0.86
91 0.85
92 0.86
93 0.83
94 0.84
95 0.83
96 0.78
97 0.73
98 0.67
99 0.65
100 0.56
101 0.54
102 0.47
103 0.46
104 0.46
105 0.5
106 0.5
107 0.48
108 0.55
109 0.53
110 0.57
111 0.58
112 0.61
113 0.62
114 0.71
115 0.76
116 0.8
117 0.87
118 0.9
119 0.93
120 0.95