Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2EV00

Protein Details
Accession A0A1Y2EV00   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MNKHNKYIYKIKKFPKKKKLKNKKRELTTNMMDRYHydrophilic
NLS Segment(s)
PositionSequence
10-25KIKKFPKKKKLKNKKR
Subcellular Location(s) nucl 20.5, mito_nucl 13, mito 4.5
Family & Domain DBs
Amino Acid Sequences MNKHNKYIYKIKKFPKKKKLKNKKRELTTNMMDRYDHTLWEKITELGNCLEDKSGDKYYSGLVDAANDIQSPDLRFSTLVEIGNLAAIDGSCEAFQKASNYLLKIVSSASPDIALERLKKQMQSYCFTEKVGYIPDYMECWNNRGALEILIRIAPRIKGGNKVLRNETATLCRILLQKLKEFKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.91
4 0.91
5 0.94
6 0.95
7 0.96
8 0.96
9 0.96
10 0.95
11 0.94
12 0.93
13 0.89
14 0.87
15 0.83
16 0.8
17 0.72
18 0.63
19 0.53
20 0.44
21 0.45
22 0.36
23 0.3
24 0.24
25 0.25
26 0.24
27 0.26
28 0.25
29 0.18
30 0.21
31 0.19
32 0.18
33 0.16
34 0.18
35 0.16
36 0.15
37 0.14
38 0.11
39 0.13
40 0.16
41 0.17
42 0.16
43 0.16
44 0.16
45 0.17
46 0.17
47 0.15
48 0.11
49 0.08
50 0.08
51 0.09
52 0.09
53 0.08
54 0.07
55 0.06
56 0.06
57 0.07
58 0.07
59 0.08
60 0.08
61 0.08
62 0.08
63 0.09
64 0.11
65 0.13
66 0.12
67 0.1
68 0.1
69 0.1
70 0.1
71 0.09
72 0.06
73 0.04
74 0.03
75 0.03
76 0.03
77 0.04
78 0.03
79 0.04
80 0.04
81 0.04
82 0.05
83 0.06
84 0.07
85 0.1
86 0.12
87 0.12
88 0.14
89 0.14
90 0.13
91 0.12
92 0.12
93 0.1
94 0.1
95 0.09
96 0.08
97 0.08
98 0.08
99 0.08
100 0.09
101 0.09
102 0.1
103 0.12
104 0.17
105 0.18
106 0.2
107 0.23
108 0.27
109 0.29
110 0.33
111 0.36
112 0.37
113 0.37
114 0.35
115 0.33
116 0.27
117 0.25
118 0.24
119 0.19
120 0.14
121 0.13
122 0.13
123 0.14
124 0.15
125 0.18
126 0.15
127 0.16
128 0.17
129 0.18
130 0.17
131 0.18
132 0.17
133 0.15
134 0.16
135 0.15
136 0.14
137 0.14
138 0.14
139 0.12
140 0.14
141 0.12
142 0.14
143 0.19
144 0.2
145 0.27
146 0.35
147 0.44
148 0.47
149 0.53
150 0.55
151 0.53
152 0.54
153 0.49
154 0.45
155 0.41
156 0.38
157 0.34
158 0.29
159 0.28
160 0.27
161 0.29
162 0.32
163 0.31
164 0.37
165 0.46