Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1YG55

Protein Details
Accession A0A1Y1YG55    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
12-31IEECSHRKCKRCNSVPYVQTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, cyto_nucl 8, mito 6, cyto 5.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR044046  E3_ligase_UBR-like_C  
IPR039164  UBR1-like  
Gene Ontology GO:0061630  F:ubiquitin protein ligase activity  
GO:0008270  F:zinc ion binding  
GO:0016567  P:protein ubiquitination  
GO:0071596  P:ubiquitin-dependent protein catabolic process via the N-end rule pathway  
Pfam View protein in Pfam  
PF18995  PRT6_C  
Amino Acid Sequences MFPLPNRISDLIEECSHRKCKRCNSVPYVQTICLLCGEMICFQSYCCIKDDHGECFLHSQTCGKGTGMYMLIKKCMVFINSGNNGQFLNAPYLDVHGEPDESYIRGKPQFLSPRRYEELRKMWLHKSIPSYISQRLENIIDYGGWETI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.4
4 0.41
5 0.45
6 0.5
7 0.59
8 0.67
9 0.74
10 0.77
11 0.77
12 0.82
13 0.77
14 0.75
15 0.68
16 0.57
17 0.51
18 0.41
19 0.33
20 0.24
21 0.22
22 0.14
23 0.1
24 0.11
25 0.09
26 0.1
27 0.1
28 0.09
29 0.08
30 0.14
31 0.15
32 0.16
33 0.15
34 0.16
35 0.15
36 0.22
37 0.25
38 0.22
39 0.25
40 0.24
41 0.22
42 0.24
43 0.24
44 0.18
45 0.16
46 0.14
47 0.11
48 0.12
49 0.13
50 0.1
51 0.1
52 0.1
53 0.11
54 0.11
55 0.12
56 0.13
57 0.13
58 0.13
59 0.13
60 0.12
61 0.11
62 0.11
63 0.1
64 0.1
65 0.11
66 0.18
67 0.2
68 0.21
69 0.2
70 0.19
71 0.18
72 0.17
73 0.17
74 0.1
75 0.1
76 0.09
77 0.09
78 0.09
79 0.1
80 0.1
81 0.09
82 0.09
83 0.07
84 0.08
85 0.07
86 0.09
87 0.09
88 0.09
89 0.1
90 0.1
91 0.13
92 0.14
93 0.16
94 0.16
95 0.24
96 0.33
97 0.38
98 0.45
99 0.44
100 0.51
101 0.54
102 0.56
103 0.52
104 0.51
105 0.54
106 0.54
107 0.56
108 0.53
109 0.53
110 0.56
111 0.54
112 0.5
113 0.47
114 0.44
115 0.41
116 0.41
117 0.42
118 0.41
119 0.43
120 0.39
121 0.35
122 0.33
123 0.33
124 0.29
125 0.25
126 0.19
127 0.15
128 0.15