Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1VEB9

Protein Details
Accession A0A1Y1VEB9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
77-96EQQKRVEEFQEKRRRKKYGSBasic
NLS Segment(s)
PositionSequence
88-93KRRRKK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004217  Tim10-like  
IPR035427  Tim10-like_dom_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF02953  zf-Tim10_DDP  
Amino Acid Sequences MDNQMQMRMAEQEFELVTELLRKITNRCYQKCYDKTYESGDVTTRESLCMDKCVLKYFEVNKNINDRLQAASQAKIEQQKRVEEFQEKRRRKKYGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.1
4 0.09
5 0.11
6 0.11
7 0.11
8 0.12
9 0.13
10 0.15
11 0.23
12 0.32
13 0.38
14 0.42
15 0.47
16 0.51
17 0.61
18 0.63
19 0.62
20 0.6
21 0.54
22 0.52
23 0.51
24 0.5
25 0.4
26 0.35
27 0.29
28 0.23
29 0.22
30 0.22
31 0.16
32 0.12
33 0.12
34 0.12
35 0.11
36 0.11
37 0.11
38 0.12
39 0.13
40 0.17
41 0.17
42 0.17
43 0.21
44 0.25
45 0.32
46 0.35
47 0.36
48 0.35
49 0.4
50 0.4
51 0.37
52 0.33
53 0.26
54 0.22
55 0.22
56 0.25
57 0.21
58 0.21
59 0.21
60 0.22
61 0.24
62 0.29
63 0.3
64 0.31
65 0.33
66 0.39
67 0.41
68 0.44
69 0.46
70 0.47
71 0.52
72 0.57
73 0.64
74 0.66
75 0.72
76 0.77