Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VMP7

Protein Details
Accession A0A1Y1VMP7   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
48-68HEEAKKCPKVVRKSPPRPVESBasic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR035426  Gemin2/Brr1  
Gene Ontology GO:0000387  P:spliceosomal snRNP assembly  
Pfam View protein in Pfam  
PF04938  SIP1  
Amino Acid Sequences MSKLKFKFKNDEYEYQNSKNVLPISDIPLNLIPTGPPKTGEIYLRLVHEEAKKCPKVVRKSPPRPVESIITNKTKNINYLRKIFNNFEEEKEKKEKSNQLIPLYLKASKQWKDSFLNDFKNSRNIFNKKELPNNYIKETFPSLEDESSWKIYLYGKSNKEMKKLSTNSGEKEIILESGIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.62
3 0.61
4 0.51
5 0.44
6 0.41
7 0.36
8 0.28
9 0.26
10 0.25
11 0.27
12 0.29
13 0.29
14 0.26
15 0.26
16 0.26
17 0.22
18 0.2
19 0.14
20 0.16
21 0.2
22 0.18
23 0.17
24 0.17
25 0.2
26 0.23
27 0.25
28 0.23
29 0.24
30 0.25
31 0.25
32 0.25
33 0.22
34 0.23
35 0.27
36 0.28
37 0.29
38 0.37
39 0.37
40 0.37
41 0.42
42 0.46
43 0.49
44 0.56
45 0.61
46 0.63
47 0.72
48 0.8
49 0.84
50 0.78
51 0.71
52 0.64
53 0.57
54 0.51
55 0.48
56 0.43
57 0.4
58 0.37
59 0.36
60 0.37
61 0.34
62 0.35
63 0.36
64 0.39
65 0.38
66 0.44
67 0.47
68 0.47
69 0.5
70 0.46
71 0.41
72 0.39
73 0.36
74 0.32
75 0.34
76 0.3
77 0.31
78 0.35
79 0.32
80 0.28
81 0.34
82 0.38
83 0.37
84 0.44
85 0.45
86 0.42
87 0.45
88 0.44
89 0.4
90 0.35
91 0.32
92 0.24
93 0.22
94 0.27
95 0.26
96 0.31
97 0.31
98 0.34
99 0.36
100 0.39
101 0.43
102 0.42
103 0.46
104 0.44
105 0.44
106 0.4
107 0.44
108 0.42
109 0.4
110 0.43
111 0.42
112 0.43
113 0.49
114 0.56
115 0.53
116 0.6
117 0.59
118 0.55
119 0.58
120 0.57
121 0.54
122 0.48
123 0.43
124 0.38
125 0.38
126 0.33
127 0.26
128 0.27
129 0.24
130 0.21
131 0.22
132 0.21
133 0.21
134 0.23
135 0.22
136 0.17
137 0.16
138 0.2
139 0.24
140 0.29
141 0.34
142 0.35
143 0.42
144 0.5
145 0.53
146 0.56
147 0.56
148 0.54
149 0.55
150 0.56
151 0.57
152 0.59
153 0.6
154 0.57
155 0.58
156 0.53
157 0.43
158 0.4
159 0.34
160 0.24