Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VCF8

Protein Details
Accession A0A1Y1VCF8   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
189-208IHIVTHPVHTKKRGRNNKKNBasic
NLS Segment(s)
PositionSequence
199-208KKRGRNNKKN
Subcellular Location(s) mito 16.5, mito_nucl 13, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002634  BolA  
IPR036065  BolA-like_sf  
Pfam View protein in Pfam  
PF01722  BolA  
Amino Acid Sequences MNSILSIPCKEKTLKALPFILTHSSYNSIQCLKKVTIPKSTLTTTSRLSTSLYTKQQTNFPFKIQYNYYSTNQDSCNIQNACTTGIESDNKDSTNNKETTSTKKFNNSETPFDIRHEGALTPMEKLLLKKLVNNFEPTAEIKVKDISDGCGSLYMVDVTSTKFDGLRMVKQHRIVMDILEEEMKTWHGIHIVTHPVHTKKRGRNNKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.45
3 0.48
4 0.46
5 0.46
6 0.45
7 0.41
8 0.34
9 0.3
10 0.27
11 0.27
12 0.26
13 0.25
14 0.26
15 0.27
16 0.26
17 0.27
18 0.29
19 0.27
20 0.32
21 0.39
22 0.41
23 0.44
24 0.45
25 0.46
26 0.46
27 0.46
28 0.45
29 0.39
30 0.38
31 0.31
32 0.31
33 0.29
34 0.24
35 0.24
36 0.22
37 0.24
38 0.28
39 0.31
40 0.31
41 0.34
42 0.35
43 0.4
44 0.42
45 0.46
46 0.4
47 0.37
48 0.41
49 0.39
50 0.42
51 0.38
52 0.37
53 0.34
54 0.37
55 0.36
56 0.34
57 0.34
58 0.32
59 0.3
60 0.28
61 0.24
62 0.2
63 0.26
64 0.22
65 0.21
66 0.2
67 0.19
68 0.19
69 0.17
70 0.16
71 0.09
72 0.11
73 0.12
74 0.12
75 0.14
76 0.13
77 0.14
78 0.14
79 0.15
80 0.17
81 0.23
82 0.23
83 0.21
84 0.24
85 0.25
86 0.33
87 0.39
88 0.38
89 0.34
90 0.41
91 0.41
92 0.41
93 0.5
94 0.45
95 0.42
96 0.42
97 0.43
98 0.36
99 0.35
100 0.33
101 0.23
102 0.2
103 0.17
104 0.13
105 0.1
106 0.12
107 0.11
108 0.09
109 0.09
110 0.09
111 0.09
112 0.1
113 0.12
114 0.15
115 0.15
116 0.19
117 0.25
118 0.3
119 0.31
120 0.35
121 0.32
122 0.27
123 0.29
124 0.26
125 0.25
126 0.2
127 0.19
128 0.16
129 0.18
130 0.17
131 0.17
132 0.16
133 0.14
134 0.15
135 0.14
136 0.14
137 0.12
138 0.12
139 0.1
140 0.1
141 0.08
142 0.06
143 0.07
144 0.07
145 0.07
146 0.08
147 0.09
148 0.08
149 0.08
150 0.09
151 0.15
152 0.18
153 0.23
154 0.3
155 0.35
156 0.4
157 0.43
158 0.46
159 0.4
160 0.4
161 0.34
162 0.27
163 0.24
164 0.19
165 0.17
166 0.15
167 0.14
168 0.12
169 0.12
170 0.11
171 0.1
172 0.1
173 0.1
174 0.11
175 0.11
176 0.12
177 0.17
178 0.23
179 0.23
180 0.25
181 0.31
182 0.35
183 0.42
184 0.49
185 0.53
186 0.56
187 0.67
188 0.75