Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1V0L9

Protein Details
Accession A0A1Y1V0L9    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
13-35KAGGKAKKKKWSAGKVKDKANNAHydrophilic
NLS Segment(s)
PositionSequence
6-30AAKAAAAKAGGKAKKKKWSAGKVKD
Subcellular Location(s) nucl 18, mito 6, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPDKAAKAAAAKAGGKAKKKKWSAGKVKDKANNAVTFDKETYDRLFKEVPTYKLITPSQLVDRLKINGSLARAALKELEQKGLIRLISSHKSQLIYTRATLEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.34
3 0.41
4 0.47
5 0.52
6 0.58
7 0.62
8 0.67
9 0.7
10 0.75
11 0.78
12 0.8
13 0.83
14 0.8
15 0.83
16 0.81
17 0.74
18 0.69
19 0.64
20 0.56
21 0.48
22 0.44
23 0.37
24 0.34
25 0.3
26 0.25
27 0.2
28 0.19
29 0.18
30 0.19
31 0.18
32 0.17
33 0.18
34 0.17
35 0.24
36 0.27
37 0.26
38 0.26
39 0.28
40 0.26
41 0.3
42 0.3
43 0.24
44 0.2
45 0.2
46 0.19
47 0.22
48 0.22
49 0.18
50 0.2
51 0.2
52 0.2
53 0.19
54 0.18
55 0.14
56 0.15
57 0.15
58 0.14
59 0.14
60 0.13
61 0.13
62 0.13
63 0.12
64 0.17
65 0.17
66 0.19
67 0.18
68 0.19
69 0.2
70 0.22
71 0.21
72 0.15
73 0.16
74 0.2
75 0.23
76 0.25
77 0.27
78 0.27
79 0.28
80 0.29
81 0.34
82 0.33
83 0.31
84 0.3