Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3AQK4

Protein Details
Accession G3AQK4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
266-307HLPPPPPPTKTKPPPPPPGSKPPPPPPSAKSKPPPPPPPSGAHydrophilic
NLS Segment(s)
PositionSequence
269-306PPPPPTKTKPPPPPPGSKPPPPPPSAKSKPPPPPPPSG
Subcellular Location(s) nucl 15, cyto_nucl 11.333, mito_nucl 9.833, cyto 6.5, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045071  BBP-like  
IPR004087  KH_dom  
IPR004088  KH_dom_type_1  
IPR036612  KH_dom_type_1_sf  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0045131  F:pre-mRNA branch point binding  
GO:0008270  F:zinc ion binding  
GO:0000398  P:mRNA splicing, via spliceosome  
KEGG spaa:SPAPADRAFT_62151  -  
Pfam View protein in Pfam  
PF00013  KH_1  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50084  KH_TYPE_1  
PS50158  ZF_CCHC  
Amino Acid Sequences DYPEINFVGFLIGPRGKTLRRLQDESGARLQIRGKGSVKEGKSAKAIDDKSMASMNGADSAEDDLHVLITSDSQQKIAKAVQLTNEVIEKLIFSPEGQNELKREQLKELAVLNGTLRETKPFDPEAYQKRQRKTMDISQIICKICGNIGHFARDCKQNNANGMKRQFDTYEPRQNNPPPPSGTSYEEQPWKKSRPDILPPWQTANTAPHSLPPPPPSLIPVQSGTYPPPSLPVQSGTYPPPPPSSQAPPPGPPAPPPGIDTKPINHLPPPPPPTKTKPPPPPPGSKPPPPPPSAKSKPPPPPPPSGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.23
3 0.23
4 0.31
5 0.4
6 0.45
7 0.51
8 0.56
9 0.56
10 0.61
11 0.64
12 0.62
13 0.58
14 0.51
15 0.43
16 0.4
17 0.4
18 0.36
19 0.34
20 0.35
21 0.32
22 0.32
23 0.38
24 0.43
25 0.42
26 0.44
27 0.43
28 0.4
29 0.42
30 0.4
31 0.37
32 0.38
33 0.38
34 0.33
35 0.34
36 0.3
37 0.28
38 0.29
39 0.25
40 0.17
41 0.16
42 0.14
43 0.14
44 0.14
45 0.11
46 0.1
47 0.12
48 0.12
49 0.11
50 0.11
51 0.07
52 0.07
53 0.07
54 0.07
55 0.05
56 0.05
57 0.08
58 0.13
59 0.13
60 0.15
61 0.17
62 0.17
63 0.2
64 0.2
65 0.21
66 0.19
67 0.21
68 0.22
69 0.25
70 0.25
71 0.23
72 0.23
73 0.19
74 0.16
75 0.14
76 0.12
77 0.08
78 0.08
79 0.07
80 0.07
81 0.11
82 0.11
83 0.17
84 0.17
85 0.19
86 0.2
87 0.22
88 0.27
89 0.26
90 0.27
91 0.23
92 0.27
93 0.25
94 0.25
95 0.25
96 0.2
97 0.18
98 0.17
99 0.14
100 0.12
101 0.11
102 0.1
103 0.09
104 0.11
105 0.14
106 0.15
107 0.18
108 0.18
109 0.19
110 0.21
111 0.28
112 0.33
113 0.39
114 0.47
115 0.49
116 0.51
117 0.57
118 0.56
119 0.54
120 0.54
121 0.53
122 0.53
123 0.52
124 0.5
125 0.46
126 0.49
127 0.44
128 0.37
129 0.29
130 0.19
131 0.16
132 0.16
133 0.14
134 0.15
135 0.15
136 0.18
137 0.19
138 0.2
139 0.22
140 0.27
141 0.27
142 0.27
143 0.3
144 0.29
145 0.35
146 0.41
147 0.42
148 0.41
149 0.41
150 0.39
151 0.36
152 0.35
153 0.3
154 0.26
155 0.3
156 0.31
157 0.39
158 0.38
159 0.39
160 0.44
161 0.47
162 0.52
163 0.47
164 0.45
165 0.37
166 0.38
167 0.41
168 0.38
169 0.37
170 0.3
171 0.29
172 0.29
173 0.33
174 0.32
175 0.32
176 0.34
177 0.35
178 0.37
179 0.39
180 0.42
181 0.43
182 0.5
183 0.53
184 0.57
185 0.6
186 0.58
187 0.58
188 0.51
189 0.45
190 0.38
191 0.34
192 0.28
193 0.24
194 0.22
195 0.21
196 0.23
197 0.25
198 0.27
199 0.25
200 0.25
201 0.24
202 0.24
203 0.23
204 0.25
205 0.25
206 0.24
207 0.23
208 0.21
209 0.21
210 0.22
211 0.21
212 0.2
213 0.18
214 0.15
215 0.17
216 0.17
217 0.17
218 0.18
219 0.19
220 0.19
221 0.2
222 0.23
223 0.23
224 0.28
225 0.28
226 0.28
227 0.29
228 0.27
229 0.29
230 0.33
231 0.36
232 0.38
233 0.45
234 0.47
235 0.45
236 0.5
237 0.5
238 0.45
239 0.41
240 0.4
241 0.35
242 0.32
243 0.32
244 0.33
245 0.32
246 0.35
247 0.35
248 0.31
249 0.36
250 0.37
251 0.38
252 0.35
253 0.4
254 0.4
255 0.47
256 0.51
257 0.49
258 0.5
259 0.54
260 0.59
261 0.63
262 0.68
263 0.69
264 0.73
265 0.78
266 0.85
267 0.85
268 0.86
269 0.83
270 0.85
271 0.82
272 0.8
273 0.8
274 0.8
275 0.81
276 0.75
277 0.74
278 0.67
279 0.7
280 0.69
281 0.69
282 0.68
283 0.7
284 0.77
285 0.8
286 0.86
287 0.81