Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VBW3

Protein Details
Accession A0A1Y1VBW3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MNKQLKKKKRVKKANPDNVPYKWHydrophilic
NLS Segment(s)
PositionSequence
6-13KKKKRVKK
Subcellular Location(s) mito 18.5, mito_nucl 11.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006616  DM9_repeat  
Pfam View protein in Pfam  
PF11901  DUF3421  
Amino Acid Sequences MNKQLKKKKRVKKANPDNVPYKWVAFNGTLPANAVSLKNSLGKTFVVARGNHKNGLLCGYADAKNKHMYTCFDGKEVVIDKYEVLTCPANRLQWVKCTNPATIGAKAVIGGYESNGQEIFVTKCKRDTVDYFGKTNKKDYCAYYGFDGKEYRINDFEVLMFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.93
3 0.9
4 0.86
5 0.77
6 0.7
7 0.6
8 0.51
9 0.41
10 0.33
11 0.28
12 0.23
13 0.22
14 0.22
15 0.21
16 0.19
17 0.18
18 0.18
19 0.15
20 0.14
21 0.13
22 0.1
23 0.1
24 0.12
25 0.15
26 0.15
27 0.15
28 0.15
29 0.15
30 0.16
31 0.18
32 0.21
33 0.22
34 0.23
35 0.29
36 0.36
37 0.39
38 0.38
39 0.36
40 0.32
41 0.28
42 0.29
43 0.24
44 0.14
45 0.13
46 0.15
47 0.17
48 0.21
49 0.21
50 0.2
51 0.25
52 0.25
53 0.25
54 0.24
55 0.23
56 0.23
57 0.28
58 0.27
59 0.22
60 0.22
61 0.21
62 0.22
63 0.21
64 0.16
65 0.1
66 0.1
67 0.09
68 0.1
69 0.1
70 0.08
71 0.08
72 0.1
73 0.09
74 0.13
75 0.14
76 0.14
77 0.16
78 0.19
79 0.18
80 0.23
81 0.28
82 0.26
83 0.3
84 0.32
85 0.31
86 0.29
87 0.32
88 0.27
89 0.24
90 0.23
91 0.17
92 0.15
93 0.15
94 0.13
95 0.09
96 0.06
97 0.05
98 0.05
99 0.09
100 0.09
101 0.1
102 0.1
103 0.1
104 0.09
105 0.11
106 0.12
107 0.16
108 0.19
109 0.19
110 0.22
111 0.25
112 0.27
113 0.3
114 0.32
115 0.34
116 0.41
117 0.44
118 0.44
119 0.49
120 0.53
121 0.49
122 0.53
123 0.49
124 0.43
125 0.44
126 0.44
127 0.45
128 0.42
129 0.43
130 0.4
131 0.42
132 0.38
133 0.38
134 0.36
135 0.29
136 0.32
137 0.31
138 0.31
139 0.26
140 0.27
141 0.25
142 0.24