Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VHN0

Protein Details
Accession A0A1Y1VHN0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
99-120ARTGDRLRKIERRNNRLNKTKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031731  CX9C  
Pfam View protein in Pfam  
PF16860  CX9C  
Amino Acid Sequences MESVINEVAEKCKKQLKAFAKCVDKHPSTYDCDCKKQKEAVQKCSEENSRLLKLINKHCKQQSVAYDNCVSNNKLNPESKCLEQFRALYLCSQVIQEGARTGDRLRKIERRNNRLNKTKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.49
3 0.52
4 0.57
5 0.65
6 0.69
7 0.71
8 0.69
9 0.7
10 0.69
11 0.61
12 0.53
13 0.5
14 0.45
15 0.42
16 0.45
17 0.49
18 0.45
19 0.51
20 0.54
21 0.53
22 0.54
23 0.55
24 0.55
25 0.57
26 0.6
27 0.61
28 0.63
29 0.61
30 0.58
31 0.56
32 0.53
33 0.44
34 0.39
35 0.34
36 0.28
37 0.26
38 0.25
39 0.23
40 0.28
41 0.35
42 0.42
43 0.39
44 0.44
45 0.45
46 0.48
47 0.46
48 0.45
49 0.42
50 0.37
51 0.36
52 0.34
53 0.34
54 0.31
55 0.31
56 0.28
57 0.22
58 0.19
59 0.22
60 0.22
61 0.24
62 0.29
63 0.28
64 0.32
65 0.33
66 0.33
67 0.36
68 0.36
69 0.34
70 0.33
71 0.32
72 0.3
73 0.29
74 0.27
75 0.21
76 0.2
77 0.18
78 0.15
79 0.14
80 0.11
81 0.1
82 0.1
83 0.1
84 0.1
85 0.11
86 0.11
87 0.12
88 0.14
89 0.19
90 0.24
91 0.28
92 0.34
93 0.41
94 0.5
95 0.59
96 0.68
97 0.72
98 0.78
99 0.84
100 0.87