Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3APP9

Protein Details
Accession G3APP9   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
46-79MHADSVKRKRKLKMKKHKLRKRRRLQRSLKKRLGBasic
NLS Segment(s)
PositionSequence
52-79KRKRKLKMKKHKLRKRRRLQRSLKKRLG
Subcellular Location(s) nucl 14, cyto_nucl 9.5, mito 9, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
KEGG spaa:SPAPADRAFT_61299  -  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MMQFGQQPSFIIPAILQQQPCIIAPAQPKIGNLVKDLQENVDEDTMHADSVKRKRKLKMKKHKLRKRRRLQRSLKKRLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.18
4 0.17
5 0.17
6 0.18
7 0.19
8 0.17
9 0.13
10 0.13
11 0.17
12 0.2
13 0.23
14 0.22
15 0.22
16 0.25
17 0.28
18 0.25
19 0.23
20 0.23
21 0.21
22 0.21
23 0.21
24 0.17
25 0.14
26 0.14
27 0.13
28 0.1
29 0.09
30 0.08
31 0.09
32 0.09
33 0.08
34 0.08
35 0.08
36 0.14
37 0.23
38 0.33
39 0.38
40 0.43
41 0.52
42 0.62
43 0.72
44 0.76
45 0.79
46 0.81
47 0.85
48 0.91
49 0.94
50 0.95
51 0.95
52 0.95
53 0.95
54 0.95
55 0.95
56 0.95
57 0.95
58 0.96
59 0.96