Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VF60

Protein Details
Accession A0A1Y1VF60    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
108-133SAILKSKKPVKAIKKREQKGARKVRAHydrophilic
NLS Segment(s)
PositionSequence
110-133ILKSKKPVKAIKKREQKGARKVRA
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR029004  L28e/Mak16  
IPR002672  Ribosomal_L28e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01778  Ribosomal_L28e  
Amino Acid Sequences MSADLVWQIVKNNNAFLVKKNGVQFSSEPGNLKNLNSFKYSGIANNKSITIGATEKGVSVSVSKAANKNLKATTVELKKGARPSAVAVKNILKAYRPDLSKDAAARVSAILKSKKPVKAIKKREQKGARKVRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.28
4 0.33
5 0.31
6 0.34
7 0.37
8 0.37
9 0.34
10 0.36
11 0.33
12 0.29
13 0.32
14 0.3
15 0.27
16 0.24
17 0.29
18 0.26
19 0.26
20 0.28
21 0.25
22 0.25
23 0.26
24 0.27
25 0.22
26 0.23
27 0.23
28 0.21
29 0.27
30 0.28
31 0.27
32 0.27
33 0.26
34 0.25
35 0.24
36 0.19
37 0.13
38 0.11
39 0.09
40 0.09
41 0.08
42 0.08
43 0.09
44 0.08
45 0.06
46 0.06
47 0.06
48 0.08
49 0.09
50 0.1
51 0.12
52 0.16
53 0.21
54 0.21
55 0.24
56 0.22
57 0.23
58 0.23
59 0.23
60 0.26
61 0.25
62 0.26
63 0.25
64 0.25
65 0.27
66 0.29
67 0.28
68 0.21
69 0.18
70 0.2
71 0.27
72 0.29
73 0.26
74 0.25
75 0.27
76 0.3
77 0.31
78 0.28
79 0.2
80 0.19
81 0.22
82 0.26
83 0.25
84 0.24
85 0.26
86 0.28
87 0.29
88 0.29
89 0.28
90 0.23
91 0.22
92 0.19
93 0.18
94 0.17
95 0.16
96 0.21
97 0.23
98 0.23
99 0.3
100 0.37
101 0.41
102 0.46
103 0.54
104 0.59
105 0.66
106 0.74
107 0.78
108 0.82
109 0.83
110 0.86
111 0.87
112 0.86
113 0.86