Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UWR5

Protein Details
Accession A0A1Y1UWR5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-31KTYRIYKIFKMKRKTQVVKSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, cyto_mito 8.5, cyto 4.5, plas 4, extr 3, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR017978  GPCR_3_C  
Gene Ontology GO:0016020  C:membrane  
GO:0004930  F:G protein-coupled receptor activity  
Pfam View protein in Pfam  
PF00003  7tm_3  
Amino Acid Sequences GFSLIYGSILVKTYRIYKIFKMKRKTQVVKSIVMYGIVMGITSIHIIMLLLWIHFNKIKLRKKYTIVTEEEYNFCEIPKSEHLGYII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.27
4 0.32
5 0.43
6 0.52
7 0.59
8 0.62
9 0.65
10 0.72
11 0.79
12 0.8
13 0.77
14 0.78
15 0.73
16 0.69
17 0.61
18 0.54
19 0.43
20 0.35
21 0.26
22 0.16
23 0.12
24 0.08
25 0.06
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.02
32 0.02
33 0.02
34 0.02
35 0.04
36 0.04
37 0.04
38 0.04
39 0.05
40 0.06
41 0.08
42 0.1
43 0.16
44 0.25
45 0.34
46 0.43
47 0.5
48 0.55
49 0.6
50 0.65
51 0.67
52 0.64
53 0.6
54 0.56
55 0.53
56 0.5
57 0.46
58 0.4
59 0.34
60 0.27
61 0.22
62 0.2
63 0.16
64 0.18
65 0.21
66 0.26
67 0.25