Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VEQ6

Protein Details
Accession A0A1Y1VEQ6   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-38SSKVEEMKKKIQKNKKQNERNEKISKHydrophilic
NLS Segment(s)
PositionSequence
19-29MKKKIQKNKKQ
Subcellular Location(s) nucl 14.5, cyto_nucl 9.833, cyto 4, cyto_mito 3.833, plas 3, mito 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MEKKASVTEKRISSKVEEMKKKIQKNKKQNERNEKISKILVDTSIKMAILSVSVSCLWLIYKKFTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.54
4 0.54
5 0.54
6 0.62
7 0.67
8 0.71
9 0.72
10 0.74
11 0.75
12 0.79
13 0.84
14 0.85
15 0.86
16 0.88
17 0.9
18 0.86
19 0.85
20 0.79
21 0.7
22 0.61
23 0.53
24 0.44
25 0.34
26 0.28
27 0.22
28 0.18
29 0.17
30 0.17
31 0.16
32 0.15
33 0.13
34 0.12
35 0.09
36 0.08
37 0.07
38 0.05
39 0.06
40 0.06
41 0.07
42 0.07
43 0.07
44 0.08
45 0.12
46 0.15