Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UT19

Protein Details
Accession A0A1Y1UT19   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
25-47LLITKKPYKNIPHSKNKWCIKIRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, plas 8, cyto_nucl 6.5, mito 6, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005821  Ion_trans_dom  
IPR043203  VGCC_Ca_Na  
IPR027359  Volt_channel_dom_sf  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0005261  F:monoatomic cation channel activity  
Pfam View protein in Pfam  
PF00520  Ion_trans  
Amino Acid Sequences RNSNILKGINDLNSNQKKIHEYVKLLITKKPYKNIPHSKNKWCIKIRNFFESSKYDTIIFFVLLINVIIHSLGHFDQSQLENDIQNISEYIFLVIYTIEVLLSFISYGFKNFFHDRWRNLCLIIVVLSYLSLIFSLDIQKSNIFLTIRLLRIGRFLKFAHGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.38
3 0.37
4 0.38
5 0.39
6 0.45
7 0.41
8 0.38
9 0.41
10 0.47
11 0.5
12 0.47
13 0.47
14 0.48
15 0.5
16 0.52
17 0.54
18 0.54
19 0.56
20 0.66
21 0.73
22 0.74
23 0.77
24 0.8
25 0.82
26 0.84
27 0.82
28 0.81
29 0.77
30 0.77
31 0.74
32 0.76
33 0.71
34 0.69
35 0.66
36 0.57
37 0.55
38 0.49
39 0.46
40 0.38
41 0.34
42 0.26
43 0.23
44 0.23
45 0.19
46 0.15
47 0.09
48 0.07
49 0.06
50 0.06
51 0.06
52 0.04
53 0.04
54 0.04
55 0.03
56 0.03
57 0.03
58 0.04
59 0.04
60 0.06
61 0.06
62 0.06
63 0.09
64 0.1
65 0.11
66 0.11
67 0.12
68 0.1
69 0.1
70 0.11
71 0.08
72 0.07
73 0.07
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.04
80 0.04
81 0.04
82 0.04
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.05
93 0.05
94 0.06
95 0.07
96 0.08
97 0.13
98 0.15
99 0.17
100 0.25
101 0.31
102 0.35
103 0.4
104 0.43
105 0.39
106 0.37
107 0.36
108 0.28
109 0.23
110 0.18
111 0.12
112 0.09
113 0.08
114 0.07
115 0.06
116 0.05
117 0.04
118 0.03
119 0.04
120 0.04
121 0.05
122 0.08
123 0.1
124 0.11
125 0.13
126 0.14
127 0.14
128 0.15
129 0.18
130 0.15
131 0.14
132 0.19
133 0.24
134 0.24
135 0.26
136 0.27
137 0.23
138 0.3
139 0.34
140 0.29
141 0.28
142 0.27