Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UXP4

Protein Details
Accession A0A1Y1UXP4    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
187-215CRNYGFKNCKTRWNWNKKKYMNNYFWRDTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, cyto 10.5, mito_nucl 8.833, cyto_nucl 8.333, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001087  GDSL  
IPR036514  SGNH_hydro_sf  
Gene Ontology GO:0016788  F:hydrolase activity, acting on ester bonds  
Pfam View protein in Pfam  
PF00657  Lipase_GDSL  
Amino Acid Sequences MTYTGKNCSGGKNWPLHFIDIHNMTLWNYGKGGSVINENLVRSSNVSYYEKLDFKKQYNLFFNNMCQGGPFSNRWNYQDSLFATNLGFNDVKPEFLFENHNKTLDIESFSESYFKVIEDLYNAGARNFLIFKIYPYCKACRFDNKYLMEYFNNLLEIKGIEFFENHPDTNIFIYNTEEFCDDVYKNCRNYGFKNCKTRWNWNKKKYMNNYFWRDTHITSLGNKLMAQNINDLLNLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.47
4 0.44
5 0.38
6 0.39
7 0.33
8 0.32
9 0.25
10 0.24
11 0.22
12 0.26
13 0.25
14 0.18
15 0.16
16 0.16
17 0.16
18 0.16
19 0.17
20 0.12
21 0.15
22 0.14
23 0.17
24 0.19
25 0.18
26 0.18
27 0.18
28 0.17
29 0.15
30 0.17
31 0.15
32 0.18
33 0.2
34 0.21
35 0.23
36 0.27
37 0.29
38 0.29
39 0.35
40 0.35
41 0.36
42 0.45
43 0.45
44 0.48
45 0.52
46 0.53
47 0.49
48 0.46
49 0.44
50 0.39
51 0.36
52 0.28
53 0.2
54 0.18
55 0.16
56 0.18
57 0.18
58 0.18
59 0.24
60 0.27
61 0.28
62 0.31
63 0.3
64 0.28
65 0.31
66 0.29
67 0.27
68 0.25
69 0.23
70 0.19
71 0.19
72 0.18
73 0.15
74 0.13
75 0.09
76 0.14
77 0.13
78 0.13
79 0.12
80 0.14
81 0.12
82 0.13
83 0.2
84 0.17
85 0.24
86 0.25
87 0.25
88 0.23
89 0.24
90 0.24
91 0.19
92 0.19
93 0.13
94 0.13
95 0.13
96 0.13
97 0.13
98 0.11
99 0.11
100 0.08
101 0.07
102 0.06
103 0.06
104 0.06
105 0.06
106 0.07
107 0.07
108 0.08
109 0.09
110 0.08
111 0.08
112 0.08
113 0.08
114 0.07
115 0.06
116 0.07
117 0.07
118 0.08
119 0.14
120 0.16
121 0.2
122 0.22
123 0.26
124 0.29
125 0.32
126 0.35
127 0.39
128 0.46
129 0.48
130 0.53
131 0.53
132 0.51
133 0.49
134 0.48
135 0.37
136 0.31
137 0.25
138 0.18
139 0.16
140 0.13
141 0.11
142 0.09
143 0.09
144 0.08
145 0.09
146 0.08
147 0.07
148 0.08
149 0.09
150 0.15
151 0.17
152 0.16
153 0.16
154 0.16
155 0.17
156 0.18
157 0.18
158 0.12
159 0.11
160 0.14
161 0.14
162 0.14
163 0.14
164 0.13
165 0.12
166 0.12
167 0.14
168 0.12
169 0.15
170 0.21
171 0.25
172 0.26
173 0.29
174 0.34
175 0.35
176 0.41
177 0.47
178 0.52
179 0.55
180 0.64
181 0.64
182 0.69
183 0.71
184 0.77
185 0.77
186 0.77
187 0.8
188 0.79
189 0.87
190 0.85
191 0.89
192 0.88
193 0.88
194 0.86
195 0.85
196 0.84
197 0.79
198 0.72
199 0.68
200 0.61
201 0.52
202 0.48
203 0.41
204 0.35
205 0.32
206 0.36
207 0.31
208 0.29
209 0.28
210 0.24
211 0.27
212 0.27
213 0.27
214 0.25
215 0.25
216 0.24