Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VBE3

Protein Details
Accession A0A1Y1VBE3   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
24-63KCENPRFEKIKKKRSQVKMACVNCKKSCKKCANVRPCLRCHydrophilic
71-101TCIDIKRKPRRIGIKRGPYKKRRTWNLEVLAHydrophilic
NLS Segment(s)
PositionSequence
76-93KRKPRRIGIKRGPYKKRR
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MNGQIIEQPFYNGNTIDEKLNFVKCENPRFEKIKKKRSQVKMACVNCKKSCKKCANVRPCLRCIQKGIADTCIDIKRKPRRIGIKRGPYKKRRTWNLEVLALVCTQLLEHEENII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.2
4 0.19
5 0.21
6 0.23
7 0.25
8 0.24
9 0.21
10 0.28
11 0.3
12 0.37
13 0.4
14 0.43
15 0.46
16 0.51
17 0.58
18 0.61
19 0.67
20 0.69
21 0.71
22 0.75
23 0.79
24 0.82
25 0.86
26 0.82
27 0.81
28 0.81
29 0.78
30 0.78
31 0.72
32 0.7
33 0.63
34 0.65
35 0.63
36 0.6
37 0.65
38 0.63
39 0.67
40 0.7
41 0.76
42 0.77
43 0.79
44 0.8
45 0.75
46 0.7
47 0.69
48 0.61
49 0.53
50 0.46
51 0.41
52 0.36
53 0.35
54 0.34
55 0.29
56 0.26
57 0.24
58 0.25
59 0.25
60 0.22
61 0.2
62 0.28
63 0.35
64 0.44
65 0.49
66 0.54
67 0.61
68 0.68
69 0.78
70 0.79
71 0.8
72 0.81
73 0.86
74 0.88
75 0.86
76 0.88
77 0.86
78 0.86
79 0.85
80 0.84
81 0.83
82 0.82
83 0.79
84 0.73
85 0.64
86 0.54
87 0.45
88 0.36
89 0.27
90 0.17
91 0.1
92 0.07
93 0.07
94 0.09
95 0.1