Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VDT0

Protein Details
Accession A0A1Y1VDT0   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
52-84KSKPTRVKENTSKPKHNKKNYNNNNNSNNKRPSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MIYKNFQKDKKEINNIKEKTVTEKKNIKTSSKIYILEQKLKELTGQKTEITKSKPTRVKENTSKPKHNKKNYNNNNNSNNKRPSSFSNTEQYNKLKKPKLKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.73
3 0.71
4 0.65
5 0.55
6 0.53
7 0.55
8 0.5
9 0.49
10 0.55
11 0.55
12 0.6
13 0.63
14 0.57
15 0.55
16 0.54
17 0.52
18 0.49
19 0.46
20 0.4
21 0.45
22 0.45
23 0.46
24 0.43
25 0.38
26 0.33
27 0.32
28 0.32
29 0.28
30 0.26
31 0.22
32 0.23
33 0.22
34 0.24
35 0.25
36 0.27
37 0.25
38 0.3
39 0.29
40 0.37
41 0.42
42 0.42
43 0.51
44 0.52
45 0.58
46 0.6
47 0.68
48 0.7
49 0.72
50 0.8
51 0.79
52 0.84
53 0.86
54 0.86
55 0.86
56 0.86
57 0.89
58 0.9
59 0.92
60 0.9
61 0.89
62 0.88
63 0.87
64 0.83
65 0.8
66 0.76
67 0.68
68 0.61
69 0.55
70 0.53
71 0.53
72 0.52
73 0.48
74 0.5
75 0.52
76 0.53
77 0.55
78 0.56
79 0.55
80 0.57
81 0.62
82 0.63