FuNGI

A0A1Y1VAT6

Protein Details

Accession

A0A1Y1VAT6

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
290-309	KKTTTKKTTIKKTTTTKKTT	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

extr 21, mito 2, vacu 2

Family & Domain DBs

InterPro	View protein in InterPro IPR002883 CBM10/Dockerin_dom IPR009034 Dockerin_dom_fun_sf IPR036749 Expansin_CBD_sf IPR036908 RlpA-like_sf
Gene Ontology	GO:0016787 F:hydrolase activity
Pfam	View protein in Pfam PF02013 CBM_10
PROSITE	View protein in PROSITE PS51763 CBM10
CDD	cd22272 DPBB_EXLX1-like

Amino Acid Sequences

MNFKSISLLNAFITIASAAVGSINDFKNYPGIVDLIQSNTKNYKSNFKYTFTDGPIYSGDGTAYGDATSGGNCLFPKKEYYNDMMYAALNNKQYNDDMGCGLCAVVVSTSNPYKAIRVRIIDQCPECEHGSLDFSDKAFKALSNKTPDRIKITWALIPCDVDVNEFPALVKPKAPLKFQFKSGSTQFWGEVEVFNTRYPVAKVELLLNGKYQSLYRRAYNYWALSSGGFGAGPYTFRVTLADNTVIQATNVEMVIPANDEGDSYSSGTQTILQQGSSSSGSSNQNVSTQKKTTTKKTTIKKTTTTKKTTTTKKTTTTKKSSTTSSSQCPNSILRQGYSCCEQNNCNIYYKDDDGDWGLTSSLKWCGIRYSCPNTVNSASNDSSCASVFNQMGYKCCRSCNVVLTDSTGKWGVEDNEWCGIRKDCK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.11
2	0.09
3	0.07
4	0.06
5	0.05
6	0.05
7	0.06
8	0.06
9	0.12
10	0.13
11	0.14
12	0.14
13	0.15
14	0.18
15	0.18
16	0.18
17	0.14
18	0.14
19	0.13
20	0.15
21	0.16
22	0.17
23	0.22
24	0.21
25	0.24
26	0.27
27	0.29
28	0.34
29	0.34
30	0.41
31	0.43
32	0.52
33	0.54
34	0.54
35	0.56
36	0.56
37	0.61
38	0.54
39	0.53
40	0.43
41	0.4
42	0.36
43	0.33
44	0.27
45	0.2
46	0.16
47	0.11
48	0.12
49	0.1
50	0.09
51	0.07
52	0.06
53	0.07
54	0.07
55	0.06
56	0.06
57	0.06
58	0.08
59	0.08
60	0.11
61	0.12
62	0.13
63	0.2
64	0.23
65	0.28
66	0.31
67	0.36
68	0.37
69	0.37
70	0.37
71	0.31
72	0.28
73	0.25
74	0.22
75	0.21
76	0.2
77	0.19
78	0.19
79	0.2
80	0.2
81	0.21
82	0.2
83	0.18
84	0.16
85	0.15
86	0.14
87	0.12
88	0.11
89	0.08
90	0.06
91	0.05
92	0.04
93	0.05
94	0.06
95	0.1
96	0.11
97	0.12
98	0.13
99	0.13
100	0.17
101	0.21
102	0.26
103	0.28
104	0.3
105	0.34
106	0.41
107	0.45
108	0.47
109	0.44
110	0.4
111	0.37
112	0.37
113	0.33
114	0.26
115	0.22
116	0.17
117	0.17
118	0.15
119	0.16
120	0.14
121	0.13
122	0.16
123	0.15
124	0.15
125	0.14
126	0.14
127	0.18
128	0.22
129	0.28
130	0.34
131	0.36
132	0.39
133	0.43
134	0.44
135	0.46
136	0.41
137	0.37
138	0.34
139	0.35
140	0.33
141	0.3
142	0.3
143	0.24
144	0.23
145	0.2
146	0.16
147	0.14
148	0.12
149	0.11
150	0.11
151	0.1
152	0.1
153	0.1
154	0.11
155	0.15
156	0.13
157	0.15
158	0.14
159	0.21
160	0.24
161	0.27
162	0.31
163	0.37
164	0.39
165	0.43
166	0.47
167	0.42
168	0.44
169	0.42
170	0.39
171	0.32
172	0.3
173	0.25
174	0.19
175	0.19
176	0.14
177	0.12
178	0.1
179	0.1
180	0.1
181	0.1
182	0.1
183	0.09
184	0.1
185	0.1
186	0.1
187	0.11
188	0.11
189	0.11
190	0.12
191	0.16
192	0.16
193	0.16
194	0.15
195	0.13
196	0.13
197	0.12
198	0.12
199	0.11
200	0.16
201	0.17
202	0.19
203	0.22
204	0.22
205	0.26
206	0.29
207	0.27
208	0.22
209	0.21
210	0.19
211	0.16
212	0.15
213	0.12
214	0.07
215	0.06
216	0.05
217	0.05
218	0.04
219	0.05
220	0.05
221	0.06
222	0.06
223	0.07
224	0.08
225	0.09
226	0.1
227	0.12
228	0.13
229	0.12
230	0.12
231	0.13
232	0.12
233	0.1
234	0.09
235	0.06
236	0.06
237	0.05
238	0.05
239	0.04
240	0.04
241	0.04
242	0.05
243	0.05
244	0.04
245	0.04
246	0.04
247	0.05
248	0.06
249	0.07
250	0.07
251	0.07
252	0.07
253	0.08
254	0.08
255	0.09
256	0.09
257	0.13
258	0.12
259	0.12
260	0.12
261	0.12
262	0.14
263	0.13
264	0.12
265	0.08
266	0.12
267	0.15
268	0.16
269	0.17
270	0.15
271	0.2
272	0.24
273	0.27
274	0.28
275	0.28
276	0.33
277	0.4
278	0.45
279	0.49
280	0.55
281	0.61
282	0.64
283	0.72
284	0.77
285	0.78
286	0.79
287	0.78
288	0.78
289	0.79
290	0.8
291	0.78
292	0.71
293	0.7
294	0.73
295	0.75
296	0.75
297	0.74
298	0.71
299	0.73
300	0.77
301	0.78
302	0.79
303	0.79
304	0.75
305	0.73
306	0.7
307	0.66
308	0.63
309	0.61
310	0.56
311	0.53
312	0.53
313	0.48
314	0.46
315	0.43
316	0.4
317	0.37
318	0.38
319	0.34
320	0.28
321	0.3
322	0.31
323	0.32
324	0.33
325	0.31
326	0.27
327	0.28
328	0.28
329	0.32
330	0.36
331	0.35
332	0.36
333	0.34
334	0.35
335	0.37
336	0.37
337	0.3
338	0.24
339	0.24
340	0.2
341	0.21
342	0.18
343	0.14
344	0.12
345	0.11
346	0.11
347	0.12
348	0.13
349	0.15
350	0.15
351	0.15
352	0.23
353	0.26
354	0.33
355	0.39
356	0.44
357	0.48
358	0.5
359	0.51
360	0.49
361	0.5
362	0.47
363	0.42
364	0.4
365	0.34
366	0.32
367	0.32
368	0.27
369	0.24
370	0.2
371	0.18
372	0.13
373	0.17
374	0.17
375	0.18
376	0.23
377	0.22
378	0.27
379	0.32
380	0.37
381	0.34
382	0.36
383	0.37
384	0.38
385	0.42
386	0.46
387	0.46
388	0.43
389	0.42
390	0.45
391	0.46
392	0.4
393	0.38
394	0.32
395	0.25
396	0.22
397	0.25
398	0.22
399	0.24
400	0.27
401	0.27
402	0.33
403	0.34
404	0.34
405	0.33

A0A1Y1VAT6

3D AlphaFold-predicted Structure Viewer