Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1V4E5

Protein Details
Accession A0A1Y1V4E5    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
327-346LPNTKPIKQRAYRLPKVKADHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13.5, cyto_nucl 13.5, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR019103  Peptidase_aspartic_DDI1-type  
IPR021109  Peptidase_aspartic_dom_sf  
Gene Ontology GO:0004190  F:aspartic-type endopeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF09668  Asp_protease  
CDD cd00303  retropepsin_like  
Amino Acid Sequences NNKADEPLTKNEKHIKILEKLENMYIEDLIRDIVSTEVKTKLVNLLDWFPKFRSEFIKSLKLTSFKNPALNVMSLFSRNKIIKVPGEVENNNAEIFLDTCSSVNLITKSALKKFKINKPCIGTITETFLQAFSNNNFNSSIYELSIKIGDLTFSEYFRLVDKDDIFDILIGVDSLKRNRFVINLVDDILYFIDLNNNPIKLTNLCYDINIYNNGNDNKQNEVNNDKEQNNTDNVNHTNFDDYYLSTYGILPALITISSESTTNNQSSDIKLDNLEIKRNIINNIITVLPLDIQNKMKDVFNTFMEVIAIKTDDLGKTKLLPHHIDLLPNTKPIKQRAYRLPKVKADALKVELTKLIENSLIEPSHSPWMIFLYFQKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.57
3 0.56
4 0.63
5 0.63
6 0.58
7 0.56
8 0.53
9 0.48
10 0.42
11 0.35
12 0.27
13 0.2
14 0.16
15 0.14
16 0.11
17 0.09
18 0.08
19 0.07
20 0.08
21 0.1
22 0.11
23 0.14
24 0.16
25 0.17
26 0.17
27 0.18
28 0.22
29 0.21
30 0.23
31 0.23
32 0.27
33 0.33
34 0.35
35 0.37
36 0.32
37 0.35
38 0.34
39 0.34
40 0.35
41 0.35
42 0.4
43 0.44
44 0.52
45 0.47
46 0.5
47 0.52
48 0.48
49 0.45
50 0.45
51 0.47
52 0.41
53 0.46
54 0.42
55 0.41
56 0.4
57 0.38
58 0.32
59 0.25
60 0.23
61 0.21
62 0.21
63 0.19
64 0.22
65 0.22
66 0.22
67 0.25
68 0.28
69 0.28
70 0.32
71 0.34
72 0.34
73 0.4
74 0.39
75 0.37
76 0.34
77 0.32
78 0.27
79 0.23
80 0.17
81 0.1
82 0.11
83 0.09
84 0.07
85 0.07
86 0.07
87 0.08
88 0.08
89 0.08
90 0.1
91 0.1
92 0.1
93 0.11
94 0.16
95 0.19
96 0.26
97 0.32
98 0.31
99 0.38
100 0.46
101 0.54
102 0.6
103 0.62
104 0.63
105 0.62
106 0.64
107 0.58
108 0.52
109 0.46
110 0.36
111 0.36
112 0.3
113 0.24
114 0.2
115 0.18
116 0.16
117 0.13
118 0.14
119 0.1
120 0.16
121 0.15
122 0.17
123 0.17
124 0.17
125 0.18
126 0.17
127 0.16
128 0.11
129 0.12
130 0.11
131 0.11
132 0.11
133 0.1
134 0.08
135 0.08
136 0.07
137 0.06
138 0.1
139 0.1
140 0.1
141 0.11
142 0.11
143 0.11
144 0.12
145 0.13
146 0.09
147 0.12
148 0.12
149 0.13
150 0.13
151 0.13
152 0.12
153 0.1
154 0.09
155 0.06
156 0.05
157 0.04
158 0.04
159 0.05
160 0.06
161 0.08
162 0.1
163 0.11
164 0.12
165 0.13
166 0.13
167 0.14
168 0.17
169 0.17
170 0.16
171 0.16
172 0.16
173 0.15
174 0.14
175 0.12
176 0.08
177 0.05
178 0.04
179 0.07
180 0.07
181 0.1
182 0.11
183 0.11
184 0.11
185 0.11
186 0.13
187 0.1
188 0.13
189 0.13
190 0.15
191 0.15
192 0.15
193 0.17
194 0.17
195 0.17
196 0.16
197 0.15
198 0.12
199 0.17
200 0.18
201 0.17
202 0.19
203 0.19
204 0.21
205 0.24
206 0.24
207 0.22
208 0.25
209 0.27
210 0.29
211 0.33
212 0.3
213 0.29
214 0.29
215 0.29
216 0.27
217 0.26
218 0.22
219 0.21
220 0.22
221 0.22
222 0.21
223 0.19
224 0.19
225 0.17
226 0.18
227 0.14
228 0.13
229 0.14
230 0.14
231 0.14
232 0.12
233 0.12
234 0.1
235 0.09
236 0.09
237 0.06
238 0.05
239 0.05
240 0.04
241 0.04
242 0.04
243 0.05
244 0.05
245 0.06
246 0.07
247 0.09
248 0.12
249 0.12
250 0.12
251 0.13
252 0.14
253 0.15
254 0.18
255 0.17
256 0.15
257 0.15
258 0.17
259 0.22
260 0.23
261 0.27
262 0.24
263 0.25
264 0.27
265 0.28
266 0.28
267 0.25
268 0.24
269 0.19
270 0.2
271 0.18
272 0.15
273 0.13
274 0.12
275 0.09
276 0.1
277 0.1
278 0.12
279 0.16
280 0.17
281 0.18
282 0.19
283 0.21
284 0.21
285 0.24
286 0.24
287 0.22
288 0.25
289 0.23
290 0.22
291 0.2
292 0.18
293 0.14
294 0.12
295 0.11
296 0.07
297 0.08
298 0.1
299 0.11
300 0.14
301 0.15
302 0.15
303 0.18
304 0.23
305 0.27
306 0.31
307 0.33
308 0.33
309 0.4
310 0.4
311 0.41
312 0.38
313 0.4
314 0.36
315 0.37
316 0.36
317 0.32
318 0.37
319 0.4
320 0.48
321 0.48
322 0.55
323 0.61
324 0.7
325 0.75
326 0.78
327 0.8
328 0.77
329 0.77
330 0.75
331 0.7
332 0.65
333 0.61
334 0.56
335 0.53
336 0.47
337 0.42
338 0.37
339 0.34
340 0.31
341 0.25
342 0.23
343 0.19
344 0.19
345 0.2
346 0.22
347 0.2
348 0.19
349 0.2
350 0.21
351 0.26
352 0.26
353 0.23
354 0.19
355 0.23
356 0.23
357 0.23