Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VD85

Protein Details
Accession A0A1Y1VD85   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
280-324SVYLYKQRRKAIKKICKLMKSTNDSKHLQKKIYNKKLHKKGLLLQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR017182  METTL16/PsiM  
IPR010286  METTL16/RlmF  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0006725  P:cellular aromatic compound metabolic process  
GO:0034641  P:cellular nitrogen compound metabolic process  
GO:0046483  P:heterocycle metabolic process  
GO:0032259  P:methylation  
GO:1901360  P:organic cyclic compound metabolic process  
GO:0044238  P:primary metabolic process  
Pfam View protein in Pfam  
PF05971  Methyltransf_10  
Amino Acid Sequences MHQHNIYYNNEPDFIKLAESYSSLKKYIKFNRYSKQGSINFKDPRACRELTYALLWCDFKIRLEIPLDTLCPVIPGRLDYIHWIEDLIFSNDNKDANSNDNNNHNNINANLSVTGIDIGTGASCIYPLLACKLHPEWNFEALELNERSYEYAKDNVSRNNMINQIKVRRVKNEQKNVFSLLLKKKKKINCGSEWIESLFLTNNDSINNQTLYNNLLRQAIIQPDYTFCMCNPPFYSSEEEMKQSRELKVEAPHSVCTGSNNEMLTEGGEVQFIIKIIDDSVYLYKQRRKAIKKICKLMKSTNDSKHLQKKIYNKKLHKKGLLLQWYTSLIGKKKSIDPIVAYLKGIKHIKEIKTTNFKQGKTVRWGVAWSFKTPPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.23
3 0.19
4 0.17
5 0.16
6 0.18
7 0.2
8 0.23
9 0.26
10 0.27
11 0.3
12 0.34
13 0.42
14 0.51
15 0.57
16 0.59
17 0.65
18 0.72
19 0.78
20 0.78
21 0.73
22 0.73
23 0.71
24 0.71
25 0.69
26 0.69
27 0.65
28 0.63
29 0.66
30 0.58
31 0.56
32 0.53
33 0.47
34 0.4
35 0.41
36 0.4
37 0.35
38 0.36
39 0.32
40 0.28
41 0.29
42 0.27
43 0.21
44 0.22
45 0.2
46 0.17
47 0.2
48 0.19
49 0.2
50 0.23
51 0.23
52 0.23
53 0.25
54 0.25
55 0.2
56 0.2
57 0.16
58 0.14
59 0.14
60 0.11
61 0.1
62 0.1
63 0.12
64 0.13
65 0.14
66 0.16
67 0.19
68 0.18
69 0.18
70 0.17
71 0.14
72 0.15
73 0.17
74 0.16
75 0.15
76 0.14
77 0.16
78 0.17
79 0.17
80 0.15
81 0.15
82 0.14
83 0.17
84 0.23
85 0.25
86 0.27
87 0.34
88 0.36
89 0.37
90 0.36
91 0.31
92 0.27
93 0.24
94 0.24
95 0.16
96 0.15
97 0.12
98 0.12
99 0.11
100 0.09
101 0.09
102 0.06
103 0.05
104 0.05
105 0.04
106 0.04
107 0.04
108 0.04
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.04
115 0.07
116 0.08
117 0.09
118 0.13
119 0.16
120 0.23
121 0.24
122 0.29
123 0.29
124 0.32
125 0.32
126 0.28
127 0.27
128 0.2
129 0.24
130 0.19
131 0.17
132 0.13
133 0.13
134 0.14
135 0.13
136 0.14
137 0.11
138 0.14
139 0.15
140 0.19
141 0.22
142 0.25
143 0.28
144 0.28
145 0.27
146 0.27
147 0.33
148 0.29
149 0.3
150 0.3
151 0.31
152 0.35
153 0.4
154 0.39
155 0.38
156 0.45
157 0.52
158 0.58
159 0.64
160 0.63
161 0.6
162 0.6
163 0.57
164 0.5
165 0.41
166 0.39
167 0.38
168 0.42
169 0.41
170 0.43
171 0.47
172 0.5
173 0.59
174 0.6
175 0.59
176 0.54
177 0.59
178 0.6
179 0.54
180 0.51
181 0.41
182 0.33
183 0.25
184 0.2
185 0.13
186 0.09
187 0.08
188 0.08
189 0.08
190 0.08
191 0.08
192 0.09
193 0.1
194 0.11
195 0.1
196 0.09
197 0.1
198 0.12
199 0.13
200 0.12
201 0.12
202 0.12
203 0.11
204 0.12
205 0.14
206 0.14
207 0.14
208 0.14
209 0.13
210 0.13
211 0.15
212 0.15
213 0.13
214 0.1
215 0.18
216 0.17
217 0.2
218 0.21
219 0.22
220 0.23
221 0.25
222 0.31
223 0.24
224 0.29
225 0.27
226 0.28
227 0.26
228 0.26
229 0.28
230 0.25
231 0.25
232 0.23
233 0.22
234 0.23
235 0.27
236 0.29
237 0.29
238 0.28
239 0.27
240 0.25
241 0.25
242 0.22
243 0.19
244 0.18
245 0.17
246 0.17
247 0.17
248 0.16
249 0.15
250 0.15
251 0.13
252 0.11
253 0.09
254 0.06
255 0.06
256 0.06
257 0.06
258 0.06
259 0.06
260 0.05
261 0.05
262 0.05
263 0.05
264 0.06
265 0.06
266 0.07
267 0.09
268 0.11
269 0.14
270 0.2
271 0.26
272 0.31
273 0.39
274 0.47
275 0.52
276 0.6
277 0.68
278 0.74
279 0.77
280 0.82
281 0.83
282 0.8
283 0.79
284 0.78
285 0.76
286 0.74
287 0.73
288 0.71
289 0.68
290 0.65
291 0.68
292 0.69
293 0.66
294 0.62
295 0.59
296 0.62
297 0.67
298 0.74
299 0.76
300 0.76
301 0.81
302 0.86
303 0.9
304 0.85
305 0.8
306 0.78
307 0.77
308 0.76
309 0.68
310 0.58
311 0.51
312 0.47
313 0.42
314 0.36
315 0.32
316 0.27
317 0.29
318 0.32
319 0.33
320 0.37
321 0.44
322 0.45
323 0.44
324 0.43
325 0.45
326 0.48
327 0.45
328 0.4
329 0.36
330 0.33
331 0.37
332 0.37
333 0.31
334 0.33
335 0.4
336 0.44
337 0.49
338 0.54
339 0.56
340 0.63
341 0.66
342 0.68
343 0.67
344 0.63
345 0.63
346 0.65
347 0.63
348 0.62
349 0.66
350 0.58
351 0.52
352 0.55
353 0.49
354 0.52
355 0.46
356 0.4