Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UXN2

Protein Details
Accession A0A1Y1UXN2    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAKSKNHTNHNQIRKQHRNGIHydrophilic
NLS Segment(s)
PositionSequence
15-54KQHRNGIKRAPHHKYPSLRGVDPKFLRNQRFAKKGSFAAR
Subcellular Location(s) nucl 17, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQIRKQHRNGIKRAPHHKYPSLRGVDPKFLRNQRFAKKGSFAARKAAAAAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.8
4 0.78
5 0.76
6 0.75
7 0.77
8 0.74
9 0.73
10 0.75
11 0.72
12 0.71
13 0.68
14 0.68
15 0.63
16 0.6
17 0.59
18 0.54
19 0.49
20 0.47
21 0.44
22 0.46
23 0.42
24 0.41
25 0.41
26 0.44
27 0.46
28 0.47
29 0.53
30 0.53
31 0.58
32 0.58
33 0.55
34 0.53
35 0.56
36 0.58
37 0.58
38 0.51
39 0.52
40 0.52
41 0.47