Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UVS7

Protein Details
Accession A0A1Y1UVS7   
Localization Confidence High
Confidence Score 20.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-33RNLGNTYKGKIIKKKRKLIEKSKIKSKYYKSHydrophilic
85-112EEKETSNKGKNKNKKTNKNRKPNPFAKAHydrophilic
135-167EENLEKKKEYFRNRKSIRHKLARKNSKGQPIMKHydrophilic
NLS Segment(s)
PositionSequence
10-28KGKIIKKKRKLIEKSKIKS
92-162KGKNKNKKTNKNRKPNPFAKAIKERNKEREEKRKELEEKKRIKEENLEKKKEYFRNRKSIRHKLARKNSKG
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013730  Fyv7/TAP26  
Pfam View protein in Pfam  
PF08524  rRNA_processing  
Amino Acid Sequences MNRNLGNTYKGKIIKKKRKLIEKSKIKSKYYKSIQNEVDDTPSYIKEIFGTDKEEEKEKKDNELSYKDFESDEGENSNSETEQNEEKETSNKGKNKNKKTNKNRKPNPFAKAIKERNKEREEKRKELEEKKRIKEENLEKKKEYFRNRKSIRHKLARKNSKGQPIMKNQLEYLLSKLEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.73
3 0.8
4 0.82
5 0.86
6 0.89
7 0.9
8 0.9
9 0.9
10 0.88
11 0.88
12 0.87
13 0.82
14 0.8
15 0.76
16 0.76
17 0.73
18 0.75
19 0.71
20 0.72
21 0.71
22 0.67
23 0.62
24 0.52
25 0.47
26 0.38
27 0.33
28 0.25
29 0.21
30 0.17
31 0.15
32 0.13
33 0.11
34 0.12
35 0.13
36 0.13
37 0.17
38 0.17
39 0.21
40 0.23
41 0.28
42 0.27
43 0.29
44 0.36
45 0.32
46 0.37
47 0.37
48 0.39
49 0.39
50 0.43
51 0.42
52 0.37
53 0.37
54 0.31
55 0.28
56 0.24
57 0.22
58 0.16
59 0.14
60 0.12
61 0.12
62 0.11
63 0.11
64 0.11
65 0.08
66 0.07
67 0.07
68 0.07
69 0.09
70 0.1
71 0.11
72 0.12
73 0.12
74 0.14
75 0.16
76 0.2
77 0.24
78 0.28
79 0.36
80 0.44
81 0.53
82 0.62
83 0.7
84 0.76
85 0.8
86 0.87
87 0.9
88 0.91
89 0.92
90 0.91
91 0.91
92 0.9
93 0.86
94 0.79
95 0.77
96 0.71
97 0.67
98 0.68
99 0.67
100 0.67
101 0.68
102 0.7
103 0.7
104 0.72
105 0.73
106 0.71
107 0.73
108 0.71
109 0.71
110 0.7
111 0.7
112 0.72
113 0.74
114 0.76
115 0.75
116 0.76
117 0.75
118 0.78
119 0.71
120 0.66
121 0.66
122 0.66
123 0.67
124 0.68
125 0.67
126 0.6
127 0.64
128 0.7
129 0.69
130 0.69
131 0.69
132 0.67
133 0.73
134 0.78
135 0.83
136 0.84
137 0.86
138 0.86
139 0.86
140 0.87
141 0.87
142 0.91
143 0.92
144 0.89
145 0.88
146 0.85
147 0.85
148 0.82
149 0.79
150 0.77
151 0.76
152 0.78
153 0.73
154 0.67
155 0.57
156 0.55
157 0.49
158 0.4
159 0.33
160 0.31