Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1V9Q4

Protein Details
Accession A0A1Y1V9Q4   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
223-243TSNCRKVLLHSKTRKNIHKGVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016195  Pol/histidinol_Pase-like  
IPR002738  RNase_P_p30  
Gene Ontology GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:1905267  P:endonucleolytic cleavage involved in tRNA processing  
Pfam View protein in Pfam  
PF01876  RNase_P_p30  
Amino Acid Sequences MFCDFNIPYPSQSNGKITEEQLINLKKILNMLQKFGYEAVAFNNTISGKIPNNGSNPIQTIPIDTSDNKKDIKQYSRLTIIMNDASQNYSLNSNNETISAYDIIAIQPQNEKIFQLACSVLDIDIISLDFSTRLPFYLKLPMVNLAIERGIHFEINYSVSLRDNNARKHLISNAANLARVTRGKNIIISSEAQKALEIRGPYDIINLSSIFGLNQALAKNCITSNCRKVLLHSKTRKNIHKGVVSISTLDELEPEESWKAGDKDLDADVLHFDMDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.36
4 0.35
5 0.39
6 0.35
7 0.33
8 0.37
9 0.36
10 0.32
11 0.3
12 0.3
13 0.23
14 0.25
15 0.3
16 0.32
17 0.3
18 0.33
19 0.34
20 0.33
21 0.33
22 0.31
23 0.26
24 0.17
25 0.16
26 0.15
27 0.16
28 0.15
29 0.14
30 0.17
31 0.14
32 0.15
33 0.16
34 0.16
35 0.14
36 0.17
37 0.21
38 0.22
39 0.25
40 0.29
41 0.29
42 0.28
43 0.29
44 0.27
45 0.25
46 0.2
47 0.2
48 0.17
49 0.18
50 0.18
51 0.17
52 0.22
53 0.24
54 0.27
55 0.26
56 0.27
57 0.31
58 0.36
59 0.41
60 0.44
61 0.45
62 0.47
63 0.5
64 0.49
65 0.44
66 0.38
67 0.34
68 0.27
69 0.23
70 0.18
71 0.15
72 0.14
73 0.14
74 0.12
75 0.1
76 0.11
77 0.12
78 0.12
79 0.14
80 0.14
81 0.14
82 0.14
83 0.14
84 0.11
85 0.12
86 0.11
87 0.09
88 0.08
89 0.08
90 0.08
91 0.09
92 0.09
93 0.08
94 0.09
95 0.11
96 0.11
97 0.11
98 0.11
99 0.1
100 0.11
101 0.11
102 0.11
103 0.1
104 0.08
105 0.09
106 0.09
107 0.08
108 0.07
109 0.07
110 0.04
111 0.04
112 0.04
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.05
119 0.05
120 0.05
121 0.07
122 0.08
123 0.09
124 0.16
125 0.16
126 0.16
127 0.16
128 0.18
129 0.17
130 0.16
131 0.15
132 0.08
133 0.08
134 0.07
135 0.07
136 0.07
137 0.07
138 0.07
139 0.07
140 0.07
141 0.08
142 0.09
143 0.09
144 0.08
145 0.08
146 0.09
147 0.09
148 0.1
149 0.16
150 0.2
151 0.22
152 0.26
153 0.28
154 0.28
155 0.29
156 0.31
157 0.32
158 0.28
159 0.28
160 0.28
161 0.27
162 0.27
163 0.25
164 0.23
165 0.17
166 0.18
167 0.18
168 0.16
169 0.18
170 0.19
171 0.21
172 0.21
173 0.2
174 0.2
175 0.2
176 0.19
177 0.2
178 0.2
179 0.17
180 0.17
181 0.16
182 0.16
183 0.17
184 0.15
185 0.11
186 0.13
187 0.14
188 0.13
189 0.15
190 0.14
191 0.11
192 0.12
193 0.12
194 0.1
195 0.09
196 0.09
197 0.07
198 0.07
199 0.07
200 0.06
201 0.08
202 0.08
203 0.1
204 0.12
205 0.12
206 0.13
207 0.13
208 0.17
209 0.2
210 0.27
211 0.32
212 0.34
213 0.38
214 0.37
215 0.42
216 0.48
217 0.53
218 0.56
219 0.6
220 0.65
221 0.71
222 0.8
223 0.83
224 0.8
225 0.79
226 0.76
227 0.73
228 0.65
229 0.61
230 0.57
231 0.48
232 0.41
233 0.34
234 0.27
235 0.21
236 0.18
237 0.14
238 0.1
239 0.11
240 0.1
241 0.12
242 0.11
243 0.11
244 0.12
245 0.17
246 0.16
247 0.17
248 0.19
249 0.18
250 0.2
251 0.21
252 0.23
253 0.17
254 0.17
255 0.16
256 0.14
257 0.13