Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1V233

Protein Details
Accession A0A1Y1V233    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
375-394SIVRNDKKRKQSFALSWNEKHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 9, extr 5, nucl 4.5, cyto_nucl 3.5, mito 2, pero 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011042  6-blade_b-propeller_TolB-like  
IPR002640  Arylesterase  
Gene Ontology GO:0016020  C:membrane  
GO:0004064  F:arylesterase activity  
Pfam View protein in Pfam  
PF01731  Arylesterase  
Amino Acid Sequences MALGVLKSIGLTSTALIVILVSFLYLPVSFLVKKGGLIKDSFPIKTKFQLSCKPIKELPLECNDFVLHEESLTSIYTCARDNIITHFNKNNIKYLPPHVYDIETKKVSKLKLRDFPKDKKMYFKNVKMYNSVSKDKTTTYLYFINHSESGNSIEKFEYLPEGHEAVWKSSLKNNLIKYASDFVPINENEFYIINKYNTNNKWMQLLENILIKSGSKIVSCDEDQDCKVVYKSIKGAGGIEISRDKKNVFVSSSFAGNILVFERKELTNSLRLSYTQDLDFIPGRLFYTSQGNENVYAFGYRSILGLTNRLFNSFVKKYIKSDFTIQSPLVLGKLVKNNDKDQFYGVLFKWKTIMELEGELTNSNNVGDRDISSLSIVRNDKKRKQSFALSWNEKTRPLVCNKLNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.08
5 0.06
6 0.06
7 0.05
8 0.04
9 0.04
10 0.04
11 0.05
12 0.05
13 0.06
14 0.07
15 0.11
16 0.11
17 0.12
18 0.16
19 0.16
20 0.18
21 0.24
22 0.27
23 0.27
24 0.29
25 0.3
26 0.33
27 0.37
28 0.37
29 0.35
30 0.35
31 0.35
32 0.4
33 0.45
34 0.44
35 0.47
36 0.55
37 0.57
38 0.63
39 0.63
40 0.63
41 0.58
42 0.58
43 0.57
44 0.52
45 0.51
46 0.5
47 0.51
48 0.45
49 0.44
50 0.37
51 0.31
52 0.29
53 0.25
54 0.16
55 0.11
56 0.11
57 0.1
58 0.11
59 0.11
60 0.09
61 0.07
62 0.09
63 0.1
64 0.11
65 0.12
66 0.12
67 0.13
68 0.14
69 0.19
70 0.26
71 0.27
72 0.3
73 0.33
74 0.38
75 0.43
76 0.44
77 0.45
78 0.38
79 0.39
80 0.39
81 0.42
82 0.44
83 0.39
84 0.4
85 0.35
86 0.36
87 0.39
88 0.39
89 0.4
90 0.35
91 0.33
92 0.34
93 0.38
94 0.38
95 0.4
96 0.44
97 0.47
98 0.53
99 0.59
100 0.65
101 0.69
102 0.74
103 0.77
104 0.77
105 0.69
106 0.7
107 0.7
108 0.7
109 0.71
110 0.7
111 0.69
112 0.66
113 0.67
114 0.61
115 0.59
116 0.56
117 0.53
118 0.51
119 0.43
120 0.38
121 0.37
122 0.35
123 0.33
124 0.3
125 0.25
126 0.24
127 0.27
128 0.26
129 0.27
130 0.26
131 0.27
132 0.23
133 0.22
134 0.18
135 0.14
136 0.18
137 0.2
138 0.19
139 0.16
140 0.15
141 0.16
142 0.16
143 0.15
144 0.13
145 0.09
146 0.1
147 0.11
148 0.12
149 0.12
150 0.15
151 0.15
152 0.13
153 0.17
154 0.17
155 0.16
156 0.19
157 0.24
158 0.25
159 0.3
160 0.3
161 0.32
162 0.32
163 0.31
164 0.3
165 0.29
166 0.25
167 0.22
168 0.21
169 0.15
170 0.2
171 0.19
172 0.19
173 0.15
174 0.14
175 0.13
176 0.13
177 0.13
178 0.1
179 0.12
180 0.1
181 0.12
182 0.14
183 0.21
184 0.22
185 0.27
186 0.26
187 0.25
188 0.27
189 0.25
190 0.24
191 0.18
192 0.18
193 0.15
194 0.16
195 0.15
196 0.12
197 0.12
198 0.11
199 0.1
200 0.1
201 0.1
202 0.07
203 0.08
204 0.09
205 0.12
206 0.12
207 0.16
208 0.15
209 0.17
210 0.17
211 0.18
212 0.17
213 0.15
214 0.15
215 0.15
216 0.14
217 0.14
218 0.15
219 0.18
220 0.18
221 0.18
222 0.18
223 0.15
224 0.17
225 0.14
226 0.13
227 0.15
228 0.16
229 0.17
230 0.17
231 0.17
232 0.18
233 0.21
234 0.23
235 0.2
236 0.19
237 0.21
238 0.21
239 0.22
240 0.19
241 0.16
242 0.13
243 0.11
244 0.1
245 0.08
246 0.09
247 0.08
248 0.09
249 0.11
250 0.11
251 0.12
252 0.14
253 0.16
254 0.2
255 0.21
256 0.22
257 0.21
258 0.21
259 0.25
260 0.25
261 0.24
262 0.17
263 0.18
264 0.16
265 0.18
266 0.19
267 0.15
268 0.12
269 0.11
270 0.11
271 0.11
272 0.11
273 0.1
274 0.17
275 0.17
276 0.19
277 0.21
278 0.22
279 0.22
280 0.22
281 0.21
282 0.14
283 0.13
284 0.11
285 0.09
286 0.09
287 0.08
288 0.08
289 0.08
290 0.11
291 0.11
292 0.15
293 0.16
294 0.21
295 0.21
296 0.22
297 0.22
298 0.2
299 0.28
300 0.26
301 0.32
302 0.32
303 0.33
304 0.36
305 0.42
306 0.45
307 0.4
308 0.45
309 0.42
310 0.4
311 0.42
312 0.38
313 0.32
314 0.29
315 0.26
316 0.19
317 0.17
318 0.14
319 0.14
320 0.22
321 0.25
322 0.31
323 0.34
324 0.4
325 0.46
326 0.48
327 0.44
328 0.4
329 0.39
330 0.33
331 0.35
332 0.3
333 0.33
334 0.3
335 0.29
336 0.29
337 0.26
338 0.26
339 0.21
340 0.23
341 0.15
342 0.17
343 0.18
344 0.17
345 0.18
346 0.16
347 0.15
348 0.14
349 0.12
350 0.1
351 0.12
352 0.11
353 0.12
354 0.13
355 0.14
356 0.17
357 0.17
358 0.17
359 0.15
360 0.18
361 0.17
362 0.23
363 0.26
364 0.3
365 0.4
366 0.49
367 0.57
368 0.65
369 0.73
370 0.74
371 0.77
372 0.79
373 0.79
374 0.78
375 0.8
376 0.77
377 0.76
378 0.76
379 0.71
380 0.63
381 0.59
382 0.54
383 0.51
384 0.5
385 0.53